SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000394 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000394
Domain Number 1 Region: 19-151
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.02e-36
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 322-409
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.64e-27
Family Ras-binding domain, RBD 0.00027
Further Details:      
 
Domain Number 3 Region: 266-335
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.84e-19
Family Ras-binding domain, RBD 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000394   Gene: ENSTGUG00000000381   Transcript: ENSTGUT00000000399
Sequence length 498
Comment pep:known_by_projection chromosome:taeGut3.2.4:13:3394656:3398450:1 gene:ENSTGUG00000000381 transcript:ENSTGUT00000000399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGSNHSVNSLPGPPATCGSTQGSVVSWAESFETLLQDRVAVTYFTEFLKKEFSAENVYFW
QACERFQQIPASDTQQLAQEARRIYDEFLSSHSVSPVNIDKQAWIGEDMLATPSPDMFRI
QQLQIFNLMKFDSYTRFVKSPLYQACLRAESQGQPLPDLRPHSRSSSPPPDLSKKTKLKL
GKSLPLGVETAGSSANRSLQRSFRKGERREPSWAGGSAMLWRESQGSLNSSASLDLGFLS
SASTAASPWTESLGDSEAELPAKPMKYCCVYLPDGTASLASVRPGHSIRDMLAGICEKRG
FSLPDIKVFLVGNEQKALVLDQECSVLADQEVKLENRISFDLEISSLNKTIRITAKSTKR
IREALQPVLGKYGVSVEQARLRRQGEPATLDLEKLVSTVSAQKLVLETPAASVVVHREAG
PCSSQAGSPTGAEPDTRWEVPSSFSRPQSSAAMNLNRRTYDLEGLVELLNRAQSCRANDQ
RGLLSKEDLVLPDFLQLP
Download sequence
Identical sequences H0YQ41
ENSTGUP00000000394 ENSTGUP00000000394 59729.ENSTGUP00000000394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]