SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000395 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000395
Domain Number 1 Region: 169-281
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.45e-28
Family Frizzled cysteine-rich domain 0.00032
Further Details:      
 
Domain Number 2 Region: 2-116
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-27
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 3 Region: 119-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000367
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000395   Gene: ENSTGUG00000000387   Transcript: ENSTGUT00000000400
Sequence length 283
Comment pep:novel chromosome:taeGut3.2.4:24:1978239:1985389:-1 gene:ENSTGUG00000000387 transcript:ENSTGUT00000000400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGCGGTLQGPEGSFSSPNYPGPYPHNALCIWHIEVGAGLAIQLRMETFSGWQCQAECPCP
ALSPSETCSPAEFSSFGEFCGHQLPPTLTSSRHVMTVLFVADEGVADVGFFATYHARNAT
EKTCSPTEFSCGNGECRALESVCDGWHDCPDGTDELNCTGVSYPAFGSVCEPVEVEMCLG
LGYNATSFPNIWLAIPDQQGAAEVLQDYQTLMELACYQHLRLLICSLFVPKCTPDGGVLQ
PCRAVCLAAEQRCRQSLGLLGILWPINCNILPDSNDPVECFQP
Download sequence
Identical sequences H0YQ42
ENSTGUP00000000395 ENSTGUP00000000395 59729.ENSTGUP00000000395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]