SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000396 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000396
Domain Number 1 Region: 168-280
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.45e-28
Family Frizzled cysteine-rich domain 0.00032
Further Details:      
 
Domain Number 2 Region: 1-115
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-24
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 3 Region: 118-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000563
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000396   Gene: ENSTGUG00000000387   Transcript: ENSTGUT00000000401
Sequence length 282
Comment pep:novel chromosome:taeGut3.2.4:24:1978239:1985386:-1 gene:ENSTGUG00000000387 transcript:ENSTGUT00000000401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCGGTLQGPEGSFSSPNYPGPYPHNALCIWHIEVGAGLAIQLRMETFSGWQCQAESGLSL
PPAHSTSTMGFFFFFPLFCGHQLPPTLTSSRHVMTVLFVADEGVADVGFFATYHARNATE
KTCSPAEFSCGNGECRALESVCDGWHDCPDGTDELNCTGVSYPAFGSVCEPVEVEMCLGL
GYNATSFPNIWLAIPDQQGAAEVLQDYQTLMELACYQHLRLLICSLFVPKCTPDGGVLQP
CRAVCLAAEQRCRQSLGLLGILWPINCNILPDSNDPVECFQP
Download sequence
Identical sequences H0YQ43
ENSTGUP00000000396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]