SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000449 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000449
Domain Number 1 Region: 959-1250
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.76e-59
Family Protein kinases, catalytic subunit 0.00000000127
Further Details:      
 
Domain Number 2 Region: 298-462
Classification Level Classification E-value
Superfamily L domain-like 2.52e-50
Family L domain 0.000000135
Further Details:      
 
Domain Number 3 Region: 1-162
Classification Level Classification E-value
Superfamily L domain-like 3.4e-46
Family L domain 0.000000238
Further Details:      
 
Domain Number 4 Region: 459-582
Classification Level Classification E-value
Superfamily Fibronectin type III 2.06e-33
Family Fibronectin type III 0.00000031
Further Details:      
 
Domain Number 5 Region: 765-909
Classification Level Classification E-value
Superfamily Fibronectin type III 1.09e-23
Family Fibronectin type III 0.00000753
Further Details:      
 
Domain Number 6 Region: 589-667,771-794
Classification Level Classification E-value
Superfamily Fibronectin type III 2.43e-18
Family Fibronectin type III 0.00000277
Further Details:      
 
Domain Number 7 Region: 162-300
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.83e-16
Family Growth factor receptor domain 0.000000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000449   Gene: ENSTGUG00000000426   Transcript: ENSTGUT00000000455
Sequence length 1342
Comment pep:known_by_projection chromosome:taeGut3.2.4:28:2346705:2392066:-1 gene:ENSTGUG00000000426 transcript:ENSTGUT00000000455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCRSMDIRNNLTRLNMLENCTVIEGHLQILLMFKTKPEDFRELSFPKLTMITDYLLLFRV
YGLESLKGLFPNLTVIRGTHLFFNYALVIFEMVHLKEIGLYNLMNITRGAVRIEKNNELC
YLSTIDWSRILDSVEDNYIVANKDDKEECGDVCPGTVKGKSNCPPTVINGIFIERCWTHD
RCQRVCPPACKSQGCTADGQCCHSECLGDCTEPNDPGRCVACRNFYLDGRCVENCPPGHY
RFEGWRCVTFSFCQELHNKCKNARESGCHVIHNNECVHECPSGYIMNSSNLHCTPCAGPC
PKVCDFGKEKTIDSVTSAHELRGCTVENGSLVINIRGGNNIAAELEANLGLIEEISGYLK
IRRSYALVSLSFFRKLHLIRGETLEAGNYSFYALDNQNLRQLWDWSKHNLTIARGKLFFH
YNPKLCLSEIHKMEEISGTKGRQERNDIALKTNGDQASCENELLKFSSIRTSHDKILLKW
EPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDVDPPPRSNEPKAQAQP
GWLLRGLKPWTQYAVFVKTLVTFSDERRTYGAKSEIIYVQTNATGHSIRPVDPISVSNSS
SQIILKWKPPSEPNGNITHYLVYWQQQAEDSELYELDYCLKGLKLPSRTWSPPFESEDPQ
KYNQTETEDVSGECCSCPKTDSQIQKELEESAFRKTFENYLHNEVFVPRMSSNARGAESQ
QPSRKRRDLGSVANATVVLPTIPSSPNNSAAAEGAEEQKPFEKVLSKESLVISGLRHFTG
YRIELHACNHDAQESRCSVAAYVSARTMPEAKADDIVGPVSHELVEKNTVHLKWQEPKEP
NGLIVLYEVNYGRLGETEEAHFCVSRKHFASESGCKLRGLQPGNYSVRIRATSLAGNGSW
TEPTYFYVADYLNAQPNIAVIIVPIIFAIIIAAIIGAAYVLVKKRQTEGPTGPLYASSNP
EYISASDGPCLIYVPDEWEVPRDKITLLRELGQGFGMVYEGIAKDIVKGEPETRVAVKTV
NESASLRERIEFLNEASVMKGFSCHHVVRLLGVVSKGQPTLVVMELMAHGDLKMIGFWET
FLANNPGRPPPTLREMIQMAAEIADGMAYLNAKKFEKGNVLNINHKVTDDCRLGFGNFGM
TRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTYSDVWSFGVVLWEISSLAEQPYQGL
SNEQVLKFVMDGGFLDQPDNCPERLHSLMQMCWQYNPKMRPTFIEIIEMLKEDLHPSFHE
VSFFYSEENKPLETEEYEMDFENMESIPLDPSSYSQRDKALGRDNGPSMALKGNYEEHIP
YTHMNGGKKNGRILSMPRSSPS
Download sequence
Identical sequences H0YQ96
ENSTGUP00000000449 59729.ENSTGUP00000000449 ENSTGUP00000000449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]