SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000474 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000474
Domain Number 1 Region: 141-672,802-997
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.36e-228
Family Motor proteins 0.0000000061
Further Details:      
 
Domain Number 2 Region: 1598-1787
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0000756
Further Details:      
 
Domain Number 3 Region: 1531-1587
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000349
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0064
Further Details:      
 
Domain Number 4 Region: 18-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000238
Family Ras-binding domain, RBD 0.022
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000000474
Domain Number - Region: 996-1040
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00283
Family Motor proteins 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000474   Gene: ENSTGUG00000000453   Transcript: ENSTGUT00000000480
Sequence length 1896
Comment pep:known_by_projection chromosome:taeGut3.2.4:28:2412572:2444095:-1 gene:ENSTGUG00000000453 transcript:ENSTGUT00000000480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKDADSAVCQAKAAYNLHIYPQLSTESAPCCKVTATKDSTSSDVIKDVINILNLDVSK
HYVLVEVKESGGEEWVLDINDSPVHRVLLWPRRAQDEHPQKDGYYFLLQERNTDGTIKYV
QMQLLSKETDARRLVERGFLPWHHEDFDDLCNLPNLTEKTLLENLKCRFLKHRIYTYAGS
ILIAINPFKFLPIYNPKYVKMYENHQLGKLEPHIFAVADVAYHTMLKKHVNQCIVISGES
GSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEAFGNAKTAHNNNSSRFGKFIQ
VNYLENGIVRGAVVEKYLLEKSRLVSQEKDERNYHVFYYLLLGVNEEERKEFHLKQPEDY
FYLNQHNLKIEDGEDLRHEFERLKQAMEMVGFLSATKKQIFSILSAILYLGNVTYKKKAT
GRDEGLDVGPPEVLDILSQLLKVKREILVEVLTKRKTVTANDKLILPYSLNEAITARDSM
KSLYSALFGWVLRINHALLNKKDMEESVTCLSIGVLDIFGFEDFETNSFEQFCINYANEQ
LQYYFNQHIFKLEQEEYKSEGITWHNIDYTDNVACIHLISKKPTGLFYLLDEESNKENAD
LSSKLFMFRKNTLGDGTFWETCMNKSSPVLKDCPGRVMILVSCFVPKNVACCREHPVASL
HYEISNKVRQMFLEIQVAVFTSAVLCMYILEFLVLGHALASWEQFGCFHRASGASSLACT
TWHPNFPGICSFGKKKGLNHPRGLVGSIFPLPFPWPPKTAPILGGSLNKKTVGFLKSRGV
KQKQIIPKNLLDSKSLKLIMSMTLHDRTTKSLLHLHKKKKPPSISAQFQTSLNKLLETLG
RAEPFFIRCIRSNAEKKEMLFDESLVLQQLRYTGMLETVRIRRSGYSAKYTFQEFIDQFQ
VLLPKNAKASKEDICAYLNKLKLNENYYQIGKTKVFMKEAERQILQDTLHKEVIRKIILL
QSWLRMVLERRRFLRMRQAAVVLQACWRSRCVRMALQRNSAAVEIQAAWRRHRQRKRFLQ
LRRRVCLLQALVRGHLQRKRKGKEQRGIKTSISSPGFACQAQFVCWACNAASLACSSLWH
SAAQRLPEPEVMFWICEVLSVCDEESPGMLSHSLSFFCAAQFFCRLGLKYSPVVNPVLVA
KPASITNGLLSKALCVDFWGKSQTRKLQRRALMQLRKETTSPWCLVSSLQTQEEPRKFQK
VSLHSASFLRGNKCCRIPSPCLNIQILSLAGSSGQAGRPQAGKESSKAKKSRTIKISKVS
SVSQNWRASMVREIANANELKHLDEFLLNKVKAPSHKKIQVFVHCLCRILKPAALGASLS
YNLKQKGIDGLAELGCIRALPVPFLNANIALNTMQSIHVSSLFTNVDSKTCIKKTLRVVS
KESSKAQLPNSTVLYHQRSALKNVVLNNWNDVIFLTKSDADVFFSINDLRSQKSGVECLF
FEATEKFRGNIKTMYSAPNGQIHVGYKDLVENYQLLVTNLAKKREEKEVKLVLNLFLSLL
DEFIRGYTKKEESEQPKQNKAQKKKRKQDRAIEEHNGHVFTNYQVSIRQSCEHCSSYIWP
MEKACLCSVCKLTCHKKCMSKIQSSCTSCGKKGEQDTEPRHFGVCVSALTSERNSVPVVL
EKLLEYVEMHGLYTEGIYRKSGSANRMKELKQLLQEDPNSVKLENYPIHTITGILKQWLR
ELPDPLMTSAQYNDFLRAVELPEKQEQLCAIYSVLEQLPQANHNTLERLIFHLVKVALIE
DVNRMSPNALAIVFAPCLLRCPDTSDPLTSMKDVSKTTMCVEMLIKEQLRKYKIKMEEIN
QLEAAESFAFRRLSLLRQNTLWPIKLGFSSPYEGKLVKGNDSGTSELDLVHEEEDVSEAN
NREKEILIDRIQSIKEENCEITYRLPELDQRGSDEE
Download sequence
Identical sequences H0YQB8
59729.ENSTGUP00000000474 ENSTGUP00000000474 ENSTGUP00000000474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]