SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000483 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000483
Domain Number 1 Region: 666-917
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-45
Family YWTD domain 0.0000113
Further Details:      
 
Domain Number 2 Region: 253-540
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 2.88e-33
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.015
Further Details:      
 
Domain Number 3 Region: 2-180
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 3.79e-21
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0086
Further Details:      
 
Domain Number 4 Region: 1228-1265
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 1101-1139
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000236
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 6 Region: 1058-1099
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 7 Region: 981-1019
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 8 Region: 1275-1309
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000589
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 9 Region: 1144-1177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 10 Region: 1026-1059
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000785
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 11 Region: 1180-1215
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000209
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000483   Gene: ENSTGUG00000000462   Transcript: ENSTGUT00000000489
Sequence length 1309
Comment pep:known chromosome:taeGut3.2.4:24:2905721:2930381:1 gene:ENSTGUG00000000462 transcript:ENSTGUT00000000489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVSLNDSHNQMVVHWAGEKSNVIVALARDSLSLLGPKNSDVYVSYDYGKSFKKISERFSF
DGGNSSEVAIAQFYHSPADNKRYIFVDAFAPYLWITTDFCNTIQGFSIPFRAADLLLHSR
NPNLLLGFDRSHPKKQLWKSDDFGQTWIMIQEHVKSFSWGVEPYDKPSTVYIERHEPSGA
STVIRSSDFFQSRENKEIILEDVEDFQLRDKYMFATKSVRLLGSSQPPSVQLWVSFNRKP
MRVAQFVTKHPIKEYYIADASEDQVFVCVSHDNNRTNLYISEAEGLKFSLSLENVLYYSP
GGAGSDTLVRYFANEPFADFHRVEGVRGVYIATLINGSFSEENMRSVITFDKGGTWELLQ
PPTQTRYGEHIDCQLSQGCSLHLAQRLSQLLNFQLRRMPILSKESAPGLIIATGSVGKNM
ARKTNVYVSSSAGARWREALSGPHYYTWGDHGGILVAIAQGTETDQLKYSTNEGETWKVF
TFSEKPVFVYGLLTEPGEKSTIFTIFGSYKENGHSWLILQINTTDVLGVPCTENDYKLWS
PSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVMVSNCSCTREDFECDFGFKLSDDL
SLEVCVPDPEFAGKPYDPPVPCPVGSTYRKTRGYRKISGDTCTGGDIESRLEGELVPCPL
AEENEFILYATRYSIHRYDLASGVSEELPLAGLRGAVALDFDYEHNCLYWADVTLDIIQR
LCLNGSSGQEIIISTGLETVEALAFEPLSQLLYWVNAGIPKIEVANPDGDLRLTVLNSSV
LERPRALALVPRDGLMFWTDWGDSRAGIYRSDMDGSLAGCIVSEGVRWPNGISVDDHWIY
WTEAYMDRIERVDFNGMQRSVILDSLPHPYAIAVFKNEIYWNDWSQLSIFRASKTSGSRM
EILVGRLNGIMDMKIFYRGKTTGQNACITKPCSLLCLPRSNNGRSCKCPEGVASTVLPSG
ELRCDCPHGYAMKNNTCIKEENTCLPNQYRCSNGNCINSIWQCDNDNDCGDMSDERNCPT
TVCDTETQFRCQGSGTCIPLSYKCDLEDDCGDNSDESHCEAHQCRNDEFSCSSGMCIRLS
WMCDGDNDCRDWSDEANCTAVYHTCEASSFQCHNGHCIPQRWACDGDADCQDGSDEDPAS
CEKKCNGFQCPNGTCIPTSKHCDGVNDCSDASDERHCEPLCTRYMDFVCKNRQQCLFHSM
VCDGIIQCRDGSDEDAGYAGCSQDPEFHRTCDQFSFQCQNGVCISLVWKCDGMDDCGDYS
DEANCENPTEAPNCSRYYQFQCGNGHCIPNRWKCDEENDCGDWSDERDC
Download sequence
Identical sequences H0YQC7
59729.ENSTGUP00000000483 ENSTGUP00000000483 ENSTGUP00000000483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]