SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000484 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000484
Domain Number 1 Region: 48-188
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.03e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00037
Further Details:      
 
Domain Number 2 Region: 162-348
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.99e-39
Family Laminin G-like module 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000484   Gene: ENSTGUG00000000475   Transcript: ENSTGUT00000000490
Sequence length 359
Comment pep:novel chromosome:taeGut3.2.4:Z:8261519:8395538:1 gene:ENSTGUG00000000475 transcript:ENSTGUT00000000490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLGASMIVNMDSVTEIFLKLLFLLSVHRQHMAVAGNKYNCDDQLVPALPQSSFSSSSELS
SSHSPGFARLNRREGAGGWSPLASNKYQWLQIDLGERTEITAVATQGGYGSSDWVTSYLL
MFSDSGQNWKHYRQEESIWAFSGNTNADSVVYYKLQHSIKARFLRFVPLDWNPNGRIGMR
VEVYGCTYRSEVVGFDGKSCLIYTLNKKLINALKDVISLKFKTMQSDGILLHREGQNGDH
ITMELTKGKLSLLINLGDTKTHPSNAQINITLGSLLDDQHWHSVLIEHFNNQVNFTVDKH
THHFHAKGEFSYLDLDYELSFGGIPVPGKSGTLSRRNFHGCLENIYYNGVNIIDLARRH
Download sequence
Identical sequences H0YQC8
59729.ENSTGUP00000000484 ENSTGUP00000000484 ENSTGUP00000000484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]