SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000487 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000487
Domain Number 1 Region: 376-389,420-626
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 4.96e-36
Family Cofactor-dependent phosphoglycerate mutase 0.02
Further Details:      
 
Domain Number 2 Region: 9-78
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000383
Family UBA domain 0.00056
Further Details:      
 
Domain Number 3 Region: 246-310
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000147
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 4 Region: 84-211
Classification Level Classification E-value
Superfamily LigT-like 0.0000296
Family Atu0111-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000487   Gene: ENSTGUG00000000479   Transcript: ENSTGUT00000000493
Sequence length 640
Comment pep:known_by_projection chromosome:taeGut3.2.4:24:3335906:3441016:1 gene:ENSTGUG00000000479 transcript:ENSTGUT00000000493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAMAAREELYSKVIPRRGRQQRGGTIRHGSALEILLSMGFPRARAQKALASTGGRSVQAA
CDWLFSHVGDPFLDDTLPREYVLYLRPTGPLAQKLSEFWQQSKQICGKNKAHNIFPHITL
CQFFMCEDSKVDALTEALQATVMRWKCKFPAPLPELYTSSNFIGLFVKEESAEVLKKFAA
DFAAEAASKADVHVEPHKKQLHVTLAYHFQSSHLPTLEKLAQSIDVKLGCDWVAAIFSRD
IRFVNHETLQVIYPYTPQNDDELELVPGDFIFMSPVEQSSTSEGWIYGISLATGCSGLLP
ENYITKADECGTWVFHGSYSILNTTACPSLQAFADGALERRQQEEQGPGDAGPLTIICQN
VQPLRISSQPGPRKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYMRSNLNMPHNLPQRS
GGFRDYEKDAPITVLGCTQARLVGEALLETNTIVDYIYSSPSLRCVQTAHNILRGMQQEN
KLKIRVEPGLFEWTKWVSGSSLPAWIPPVDLAAATLSVDTTYRPHIPVSKLAVSESYDTY
ISRSSQVTKEIISECKGKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLG
FCSCEELGDTGVWQLTDPPILPLTHGPTGGFNWRETLLQE
Download sequence
Identical sequences H0YQD1
59729.ENSTGUP00000000487 ENSTGUP00000000487 ENSTGUP00000000487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]