SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000504 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000504
Domain Number 1 Region: 105-317
Classification Level Classification E-value
Superfamily L domain-like 2.96e-42
Family Internalin LRR domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000504   Gene: ENSTGUG00000000492   Transcript: ENSTGUT00000000510
Sequence length 372
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:9063822:9128522:-1 gene:ENSTGUG00000000492 transcript:ENSTGUT00000000510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHQVIIFDFSVIRGLWETRVKKSKERQRKEKERLEQSALERIKQEWNLILECRKKGIPQ
SKYLKNGFVDINAKNLDTNGKNPQLKKSHALSDGVNKEQDKFIFQLSGEQWTELPDSLKE
QTYLKEWHVYNTLIQTIPAYLALFQDLRVLELSKNQINYLPAEIGCLKNLKVLNVSFNNL
KSVPPELGDCENLEKLDLSGNMEITELPFELSNLKQLTFVDVSANKFHSIPICVLRMSNL
QWLDISSNSLKDLPEDIDRLDELQTLLLQKNKLTYLPRALVNMPKLSLLVVSGDDLVEIP
TAICESTTGLKFVSLKDSPVETIVCEDTEEIRENEREREQVEKEFMKAYIEDLRERESTP
SYTTKVMLSLQL
Download sequence
Identical sequences H0YQE8
ENSTGUP00000000504 59729.ENSTGUP00000000504 XP_002193813.1.42559 ENSTGUP00000000504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]