SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000506 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000506
Domain Number 1 Region: 122-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000103
Family Cripto EGF-like domain-like 0.0038
Further Details:      
 
Domain Number 2 Region: 88-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000219
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000000506
Domain Number - Region: 44-87
Classification Level Classification E-value
Superfamily BB1717-like 0.0837
Family BB1717-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000506   Gene: ENSTGUG00000000498   Transcript: ENSTGUT00000000512
Sequence length 195
Comment pep:novel chromosome:taeGut3.2.4:Z:9177812:9181426:1 gene:ENSTGUG00000000498 transcript:ENSTGUT00000000512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYWGNHLRILFTATLVWQAVHLEKGPESEEWKEDVKSLNVTAQKRQPKNEGSFINALSDM
SQSYESRKQQSSRSFVPFTGITESKKLNRRCCQNGGTCILGTFCACLKHFTGRYCEYDER
QSNCGSIPHGVWVLQDCWLCRCGYGTLHCLSEIRQSNCELTSETAEIIRLYSNGLRLQQT
VFSVTCLLAVLLEFC
Download sequence
Identical sequences H0YQF0
59729.ENSTGUP00000000506 ENSTGUP00000000506 ENSTGUP00000000506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]