SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000508 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000508
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000321
Family Glutathione peroxidase-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000508   Gene: ENSTGUG00000000500   Transcript: ENSTGUT00000000514
Sequence length 188
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:9302660:9307134:1 gene:ENSTGUG00000000500 transcript:ENSTGUT00000000514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLDADGRSVPFQALFAEQKAIVLFVRNFLCYTCKEYVEDLAKVPKAFLQESNVRLIVIGQ
SSYHHIKPFCSLTGYTHEMYVDPPREIYKILGMKRGEGNKASVRSPHVKSNTFLGSIRSI
WRAMTGPAFDFQGDPAQQGGALIIGPGNEVHFLHLDKNRLDHVPINTVLQLAGVKTVNFS
NKPQIIDI
Download sequence
Identical sequences H0YQF2
59729.ENSTGUP00000000508 ENSTGUP00000000508 ENSTGUP00000000508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]