SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000527 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000527
Domain Number 1 Region: 86-189
Classification Level Classification E-value
Superfamily Cadherin-like 7e-22
Family Cadherin 0.00094
Further Details:      
 
Domain Number 2 Region: 191-304
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-17
Family Cadherin 0.0036
Further Details:      
 
Domain Number 3 Region: 526-655
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000004
Family Cadherin 0.0022
Further Details:      
 
Domain Number 4 Region: 297-395
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000002
Family Cadherin 0.002
Further Details:      
 
Domain Number 5 Region: 2-111
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000314
Family Cadherin 0.0097
Further Details:      
 
Domain Number 6 Region: 408-540
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000528
Family Cadherin 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000527   Gene: ENSTGUG00000000517   Transcript: ENSTGUT00000000535
Sequence length 834
Comment pep:known_by_projection chromosome:taeGut3.2.4:13:3647306:3652576:-1 gene:ENSTGUG00000000517 transcript:ENSTGUT00000000535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVAYDPDKGINSNFELSLQGPNANAFTVFPTTIAGAGEVQILVQNSALVDYEISHVMVVQ
VIANDTGNPTDCCSTATVTIDLIDSNDHIPEFPQSTYTLSVMENSPDGTVITPNITAYDP
DSGVGQITYQLLPETICDIFTVNATTGALLVRNGSLLDRETRSIYYANLQAKDGGDLVST
TVLEITVLDANDMAPVVIGSYFISVEEGQNVSTQIQAIDNDEPDSPNSKLGFMILPGLFS
DNFTISEDTGEMHSKEPLDCEALEDERGQMVVTVMVYDHGKPPLNTTVNVTITVGDLNDN
IPVFLNQSYEFSVFEDSPGSFVGEVNATDADRTEINSRISFRLEHGSSNFLIRSTRLGPG
NYSGQLSVDPEMSLDYDTLQQKFFTLTVLAENTAADNAGDKANVSAIVHILDVNDESPNI
MPGSLQDASVAENGTQQGLIHTLSAFDPDTNHSLVFEELAVACFKGDSSAEDVCWDWFVL
APNGSVLVNSSDIDYEVCDRVLLTLRVEDLYTEKGNRYSQNETLRIIIIDVNDNMPVFEA
ISETFVVVPEISPVELQVATVKATDADSGLGGTITFSIVSVVLVEDNGVSRPFENLFGVS
TTPDKGAYIGSIRVASNLDESLKGQYKVTVEAKDGEEPVHRAQTVLSIFTVDQSYRVRLQ
FVTTVEEVQSNSENIKLALTTVTKAAVYVVAIRSVEDTRVVDAKSVMEAYFVYSNGTALD
VNDLSILIQSDPVGLAELVKLGLAVIGPGEVTKPTKEVELIGIIAGLAAFLLIFILIMTL
VLVLTTRSYKRKLSAMKALKVATTFNPATAQQGAGIPGTNQYNAEGANPMLNQP
Download sequence
Identical sequences H0YQH1
59729.ENSTGUP00000000527 ENSTGUP00000000527 ENSTGUP00000000527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]