SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000528 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000528
Domain Number 1 Region: 569-828
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.43e-89
Family Eukaryotic proteases 0.000000191
Further Details:      
 
Domain Number 2 Region: 314-420
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 3 Region: 197-306
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-22
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 4 Region: 59-143
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000458
Family SEA domain 0.0076
Further Details:      
 
Domain Number 5 Region: 461-498
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 6 Region: 427-462
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 7 Region: 497-536
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000089
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 8 Region: 540-580
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000528   Gene: ENSTGUG00000000515   Transcript: ENSTGUT00000000536
Sequence length 829
Comment pep:known_by_projection chromosome:taeGut3.2.4:24:3867437:3876606:-1 gene:ENSTGUG00000000515 transcript:ENSTGUT00000000536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDMNNLDEGVEFLPAMNSKKMEKRGPKRQVVITVLIIVFLLVSLTTGLLFWHFKYRNTPV
QKVFNGHLRVLNWEFLDAYENSSSPEFSMLAKKVKSTVEEIYRNHADIGPYHRETVITAF
SEGSVIAYYWSEFLVPKYREGSLDRAMADKQSLVQRWNPRLRNPMLKVESVIAFPVDPSI
AHSARDNSCMFSLHAKEGEVTSFTTPGFPNSPYPNNALCYWALRADASSSISLTFKTLEL
EPCRDDSDYIKVYDSLSPVEPHALVRLCGNYAPSYNLTFLSSQNVMLVTLVTNKEGRFPG
FKAEFFQLPKMKACGGILKGDSGTFTTPYYPAHYPPDMDCVWNIEVPSIKNVKVRFNMFF
VLEPGIPVSSCTKDYVQINGTRYCGERSQFVVASTTNKIELRFHSDQSYTDTGFSAEFLS
YDSSDPCPGKFTCNTGRCIDRSMRCDGWLDCVDGSDERSCTCTEQQFRCQNGWCKPKFWV
CDNVNDCGDNSDELQCSCSADSFKCNNGKCVPSTQKCDGKDDCGDGSDEGRCSTGQTTVP
CKEYTYKCRSGRCISKQNPECDGEQDCDDHSDEDNCNCGLRSYVRKSRIVGGQNSDVGEW
PWQVSLHVKGQGHICGASLVSASWLVSAAHCFLPLQGIRYSDPSLWTAYLGLTDQGDRSS
PNVQTRKIKRIISHPFFNDYTYDYDIAVLELQSPVTFTAVVQPICLPDATHNFPVGKDLW
VTGWGATAEGGTGASILQKAEIRLINQTVCNQLLTDQLTPRMMCVGILTGGVDACQGDSG
GPLVSVEPSSRMFLAGVVSWGDGCAQKNKPGVYSRLTSLRDWIQEHTGL
Download sequence
Identical sequences H0YQH2
59729.ENSTGUP00000000528 ENSTGUP00000000528 ENSTGUP00000000528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]