SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000544 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000544
Domain Number 1 Region: 136-283
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.49e-33
Family UAS domain 0.025
Further Details:      
 
Domain Number 2 Region: 322-450
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.83e-20
Family UBX domain 0.0077
Further Details:      
 
Domain Number 3 Region: 17-55
Classification Level Classification E-value
Superfamily UBA-like 0.0000459
Family TAP-C domain-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000544   Gene: ENSTGUG00000000527   Transcript: ENSTGUT00000000552
Sequence length 452
Comment pep:known_by_projection chromosome:taeGut3.2.4:13:3674289:3688034:-1 gene:ENSTGUG00000000527 transcript:ENSTGUT00000000552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGQRRQKMAAPEERELTAEQTEKLLQFQDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNE
QEGVPSVFNPPPLRPLQVNTADHRIYSYVVSRPQPRGLLGWGYYFIMLPFRFTYYTLLDI
FRFALRFIRPDPRSRVTDPVGDIISFIHMFEEKYGRIHPVFYQGTYSQALNDAKRELRFL
LVYLHGDDHQDTDEFCRNTLCAPEVITLINTRMLFWACSTNKPEGYRVSQALRENTYPFL
AVIMLKDRRMTVVGRLEGLIQADDLINQLMFIMDANQTYLVSERLEREERNQTQVLRQQQ
DEAYLASLRADQEKERKKKEERERKKKKEEEVQQQKLAEERRRQTLQEEKERKSECLPPE
PHPDDPESVKIIFKLPNDSRVERRFHFTQSLTVIHDFLFSLKESPEKFQIEANFPRRVLP
CLPTEEWPNPPTLQEAGLSHTEVLFVQDLTDD
Download sequence
Identical sequences H0YQI7
59729.ENSTGUP00000000544 ENSTGUP00000000544 ENSTGUP00000000544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]