SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000549 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000549
Domain Number 1 Region: 2-218
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.84e-73
Family Eukaryotic proteases 0.0000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000549   Gene: ENSTGUG00000000525   Transcript: ENSTGUT00000000557
Sequence length 219
Comment pep:novel chromosome:taeGut3.2.4:28:2724274:2726586:1 gene:ENSTGUG00000000525 transcript:ENSTGUT00000000557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQIVGGHEARPHSHPYMAYLKLADMGGCGGFLVAPNWVMSAAHCMGNITVILGAHNIHEP
EKTQQVRGVLKYHEHPEYNPSTMENDIMLLQARRAVAVNDYIQPIPLPRAGSDLPTGTKC
MIAGWGLIDEDRTTNKLFETKVSIYSRRKCTLFYPHLDSGMVCAGSFHELKDSSQGDSGG
PLVCNKVAQGIVSFGYDSPPGVYTRISNYLPWIKKVMKK
Download sequence
Identical sequences H0YQJ2
ENSTGUP00000000549 ENSTGUP00000000549 59729.ENSTGUP00000000549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]