SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000579 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000579
Domain Number 1 Region: 39-82
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000624
Family Ovomucoid domain III-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000579   Gene: ENSTGUG00000000570   Transcript: ENSTGUT00000000590
Sequence length 82
Comment pep:novel chromosome:taeGut3.2.4:13:3888240:3890357:1 gene:ENSTGUG00000000570 transcript:ENSTGUT00000000590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKITGVLLLFSLALFCISVPATDALQAASVYCKDQRGLRDVCSMEYVPHCGSDGVTYPNK
CTFCNAFLRSRGDLGLRSLNAC
Download sequence
Identical sequences H0YQM2
ENSTGUP00000000579 59729.ENSTGUP00000000579 ENSTGUP00000000579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]