SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000582 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000582
Domain Number 1 Region: 10-55
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 7.76e-17
Family Ovomucoid domain III-like 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000582   Gene: ENSTGUG00000000575   Transcript: ENSTGUT00000000593
Sequence length 55
Comment pep:novel chromosome:taeGut3.2.4:13:3906722:3907640:1 gene:ENSTGUG00000000575 transcript:ENSTGUT00000000593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVQICREFLNRSVYCTRESNPHCGTDGVTYGNKCAFCKAVLRSGGKIRLKHLGKC
Download sequence
Identical sequences H0YQM5
ENSTGUP00000000582 ENSTGUP00000000582 59729.ENSTGUP00000000582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]