SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000589 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000589
Domain Number 1 Region: 69-163
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.84e-17
Family Ubiquitin-related 0.0000897
Further Details:      
 
Domain Number 2 Region: 465-539
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000146
Family UBA domain 0.0011
Further Details:      
 
Domain Number 3 Region: 350-416
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000383
Family UBA domain 0.016
Further Details:      
 
Domain Number 4 Region: 234-386
Classification Level Classification E-value
Superfamily TPR-like 0.0000000847
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 
Domain Number 5 Region: 433-472
Classification Level Classification E-value
Superfamily UBA-like 0.000000119
Family UBA domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000589   Gene: ENSTGUG00000000564   Transcript: ENSTGUT00000000600
Sequence length 610
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:6701376:6715000:1 gene:ENSTGUG00000000564 transcript:ENSTGUT00000000600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKKYLIAKLTKCLRDDKIQLWKPPYTNEKKEAGEEMKELVQKYSSKLNINKNDAENIL
EEIRCKAIERGTGNENFKVTGIARLDIYLPPQLRLESRKIPLETSLFITGKELRSQIAQE
YALQENAVKIIINKKQLDLGKTLEDQGVTHNAKVMVLQLEQSDEETKRKVQEEELQCKKE
KEINDKMQRTKKGLEILAEREEYLDADSVPYLDIANQTGRSIPIPPQAKKALVLAMAYHE
KGRALMKKKEYEIALPYLLDADKHFCECSTELLNTVDNYAVLQLDIVWCYFRLEQLDCLD
DAEKKLSTAQRCFQRCYGENHERLIDIKGNYGREKVLFLRLYLLQGIGHYHSGREKEAAE
YIQKASSLYGELSIDPDKVDRLSLLGFSEQEARLALRACHGNVEHAANLITNRREEKAQI
RREERAKRRRRLEDINTLKSMGYPERAAQIALQKTQGNLDKAFKFILDNPELLLEDDDDD
SVAMDQFQVSQESIEQLTYMGFSRESAEQALKVFKGNIHVASQTLAHYGGVLPPSLLLSS
EGSSPSEESTSSKDLLTESAGSSSSPTDEDMETDAVNEILEDIPEHEEDYLDLTLEEEEQ
IIHEYLSYIQ
Download sequence
Identical sequences H0YQN2
ENSTGUP00000000589 ENSTGUP00000000589 59729.ENSTGUP00000000589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]