SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000631 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000631
Domain Number 1 Region: 1599-1726
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-36
Family Cadherin 0.00089
Further Details:      
 
Domain Number 2 Region: 1070-1186
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-32
Family Cadherin 0.0015
Further Details:      
 
Domain Number 3 Region: 218-338
Classification Level Classification E-value
Superfamily Cadherin-like 1.18e-30
Family Cadherin 0.0012
Further Details:      
 
Domain Number 4 Region: 436-546
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-30
Family Cadherin 0.0011
Further Details:      
 
Domain Number 5 Region: 1707-1817
Classification Level Classification E-value
Superfamily Cadherin-like 1.05e-28
Family Cadherin 0.002
Further Details:      
 
Domain Number 6 Region: 1501-1604
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-26
Family Cadherin 0.0018
Further Details:      
 
Domain Number 7 Region: 1810-1915
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-25
Family Cadherin 0.00095
Further Details:      
 
Domain Number 8 Region: 857-969
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-24
Family Cadherin 0.0052
Further Details:      
 
Domain Number 9 Region: 547-653
Classification Level Classification E-value
Superfamily Cadherin-like 5.1e-24
Family Cadherin 0.0027
Further Details:      
 
Domain Number 10 Region: 1385-1508
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-22
Family Cadherin 0.0013
Further Details:      
 
Domain Number 11 Region: 1910-2028
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-22
Family Cadherin 0.0026
Further Details:      
 
Domain Number 12 Region: 649-756
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-21
Family Cadherin 0.00096
Further Details:      
 
Domain Number 13 Region: 763-869
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-21
Family Cadherin 0.0049
Further Details:      
 
Domain Number 14 Region: 112-222
Classification Level Classification E-value
Superfamily Cadherin-like 2e-17
Family Cadherin 0.004
Further Details:      
 
Domain Number 15 Region: 967-1074
Classification Level Classification E-value
Superfamily Cadherin-like 1.4e-16
Family Cadherin 0.0027
Further Details:      
 
Domain Number 16 Region: 2120-2197
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-16
Family Cadherin 0.0043
Further Details:      
 
Domain Number 17 Region: 331-439
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-16
Family Cadherin 0.0056
Further Details:      
 
Domain Number 18 Region: 1314-1397
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000685
Family Cadherin 0.0033
Further Details:      
 
Domain Number 19 Region: 2024-2106
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000143
Family Cadherin 0.0015
Further Details:      
 
Domain Number 20 Region: 1179-1266
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000228
Family Cadherin 0.0036
Further Details:      
 
Domain Number 21 Region: 26-111
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000828
Family Cadherin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000631   Gene: ENSTGUG00000000619   Transcript: ENSTGUT00000000642
Sequence length 2200
Comment pep:known_by_projection chromosome:taeGut3.2.4:1B:1002030:1032986:-1 gene:ENSTGUG00000000619 transcript:ENSTGUT00000000642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLELLILGGLRAGMGSAVLGTLDLQIDEEQPAGTIIGDISAGLPPETSAYMYFISAQE
GSGVSTDLGIDENTGIIKTARVLDRETRDHYSFIAVTPEGITVEVNIQVNDINDHAPAFP
KQHSTFQIPEHTPIGSRFPLDPADADSGLLNTQGYMIKGGNVGQAFRLETRRGPNGVLYL
DLVVSNVLDRENRSSYSLLLEAYDGGSPPRSTQMTLDVSIQDINDNAPSFNQSRYHTLIS
ENLKPGSSILQVFASDADEGDNGDVIYEINRRQSDPDQYFTIDARTGVIKLNKGLDYEVR
KVHELVVQARDKAVHPEVTTAFVTIHVRDYNDNQPTMTIIFLSEDGSPQISEGAQPGQYV
ARISVSDPDYGEYSNVNVTLEGGDGKFALTTKDNIIYLICVDQLLDREERDSYDLRVTAT
DSGTPPLRAESAFVLQVMDVNDNPPLFDQQEYKQSIPEVVYPGSFVLQVTARDKDQGPNG
EVRYSILHGRDTHSSWFTIDPATGIITTAAPLDYEKDPQPQLTVLATDRGTPALSSSAVV
HVALQDVNDNEPVFKSNFYNVSLKENTPVGTCFLQVTATDSDSGAFGSLSYSIGSGIGSI
IPTQFSIDKHSGQLCTVQPLDRDEGTSAYDFTIIAVDGGGLNSMVYVKVFLEDTNDNRPV
FYPLEYAASISTQSMPGTAVLRVTAHDKDEGLNGRVTYRIVLGNSPPLFSLNKDTGVISL
SWSLSGKANTLVQLVISAQDGGGLQAQPNARVNISIVEGTVSPPVFEQAQYFFSVPEDMP
QGASVGSVQAQNPPGHADDIFYSISSGDPHGYFSIDSASGQLRTSLPLDHESQSVLILDV
QARSGSPPAYSNTRVKISVSDVNDNMPAFPTPSDSILLPEATEPGTTVYTLQAEDRDSGA
NGQVTFELLSGGEGTFIVERASGAVRLLGALQYEAISAYSLAIVARDSGIPQLSSTFTLL
VHVQAEDDNGPIFDTLTYRVEVQEGVPVSTRFLQVRALAHDVESTALTYHLRADGDAASF
GIVPESGWLYVKSALDRETRDLYVLTVLASVGGTGAAADARKTGTSTVRISITDENDNSP
RLSEERYFFTVSENQAPGSTVGRVTASDRDAGQNSRLTYRLLQHDPNFLIHTQTGEVSTK
HSLDREQQSNFQLLVIVQDGGAPPRSATGTIYVTVLDENDNAPAFLHVGSGQELTVQGLE
EKPSGFWSPSLQDNDPDEGENGTIIYSLIGAWAERFTLHEATEELMTAAVLQRRDRTQYI
FPVTACVLAIAPCATHSFLSSQVLSSSRVLPRPDATVLTLHPLEGVKPGSVIGSVAPLDA
PAQGQLIYTVVGGGGDGTFVVDSMTGEIYAARELDYEAGARHVLQVSAEDTQHGYPSSRL
VLVQIHVQDCNDQAPTFPEDPITIVVPENAQAGSSIFTFQALDGDGVGPNSQVRYALLHL
EPPGAPFQLDGRSGQLSLRQGLDREATASFLLVVEATDQARNVSQRRSAAVTARVFVTDE
NDNVPVFLSPATVSVMEDQPTGFVALHVVAQDSDLGENGRVSYSLRAGNADGRFHLNPST
GALSIVGALNREEVAQHNLTVVATDHGFPRLSATQLLSVLVLDVNDEAPVFEKPEYEAHV
MENLPAGSPVLQVLATDRDLGANGQVSYGGLSGGPFSIHPQTGLIVTTRALDREEQEQHV
LTVYARDAGLPPSLTKATVWVTVGDENDHAPHLESESFSVEVPENQSRVALYTLRATDPD
GGENGRLEYRVAGGDPGQDFSLDPVSGVLSTAHALDREQIASYSLIVVVQDHGSPPRSAT
MSVTVQVLDLNDNAPSFAQASYTVEVPEDLPVGALVLQLVAEDPDEGTNGQVSYYLGNES
LGMFQVEPQSGCIRSAQALDRERQPTYSFLAKAVDSAPWEPKSAAVRVTVVVRDVNDHVP
AFLQSPLTVNLSRDTPLMDVVATMKAEDRDAGANASILYRFATPSSAFMINSYTGEIRLL
QRLGSLSQRQRTLFVLAMDLGQPALSSTGVVVIHVQEEPYQGLRFPRSTSDVALAENAAP
GTEVASVQAIHTGGSSGHITYSIVSGNERNTFLIQPSSGCISVQDSSSLDFEASPQLRLV
IQAETAASFGFMAINLNQDVNDNLPRFQLQNYVAFIWESQSYDSPVIQVLADDLDQGVNG
QVTYAINQSLPMPGLYHIDPQTGTITTAAILDREIWSQTR
Download sequence
Identical sequences H0YQS4
ENSTGUP00000000631 59729.ENSTGUP00000000631 ENSTGUP00000000631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]