SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000647 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000647
Domain Number 1 Region: 6-233
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.6e-59
Family Eukaryotic proteases 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000647   Gene: ENSTGUG00000000638   Transcript: ENSTGUT00000000658
Sequence length 234
Comment pep:known_by_projection chromosome:taeGut3.2.4:28:2943204:2945055:-1 gene:ENSTGUG00000000638 transcript:ENSTGUT00000000658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPGTQGSQIIGGKAAAPHSRPFIASIQMDGEHVCGGFLVWPKWVMTAAHCFIPRRIPSVR
VVLGAQRLQEPEGSQQIFSVQLGGSAPSAKPPTASLPTQLNRSATLNKYVRRIRLPSPHT
DLKPGTVCSVMGWGDTSNFGDQPSELMETNTTIVKRSLCRTLWRGKVSANMLCGASRSTT
LQGVCAGDSGGPLVFKDKVHGIVSFSGERCGDRRFPDIYTKISNYIGWVHDVVR
Download sequence
Identical sequences H0YQU0
59729.ENSTGUP00000000647 ENSTGUP00000000647 ENSTGUP00000000647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]