SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000668 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000668
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.95e-27
Family Eukaryotic proteases 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000668   Gene: ENSTGUG00000000658   Transcript: ENSTGUT00000000679
Sequence length 99
Comment pep:novel chromosome:taeGut3.2.4:28:3026484:3027877:1 gene:ENSTGUG00000000658 transcript:ENSTGUT00000000679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPRGRILRGSEARPHLKPYMASLQLDGQHVCGGFLIAPQWVLSAAHCIEETDGKLFQVLL
GAHSLTEPEPHKRLYQVRAQFPHPGSNIHNNKDDLLLLQ
Download sequence
Identical sequences H0YQW1
ENSTGUP00000000668 59729.ENSTGUP00000000668 ENSTGUP00000000668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]