SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000714 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000714
Domain Number 1 Region: 2948-3080
Classification Level Classification E-value
Superfamily CalX-like 8.24e-32
Family CalX-beta domain 0.0011
Further Details:      
 
Domain Number 2 Region: 3915-4061
Classification Level Classification E-value
Superfamily CalX-like 1.02e-29
Family CalX-beta domain 0.0028
Further Details:      
 
Domain Number 3 Region: 2106-2235
Classification Level Classification E-value
Superfamily CalX-like 4.58e-28
Family CalX-beta domain 0.0013
Further Details:      
 
Domain Number 4 Region: 4390-4536
Classification Level Classification E-value
Superfamily CalX-like 1.96e-27
Family CalX-beta domain 0.0018
Further Details:      
 
Domain Number 5 Region: 2221-2372
Classification Level Classification E-value
Superfamily CalX-like 4.19e-27
Family CalX-beta domain 0.0044
Further Details:      
 
Domain Number 6 Region: 1004-1128
Classification Level Classification E-value
Superfamily CalX-like 1.26e-26
Family CalX-beta domain 0.0022
Further Details:      
 
Domain Number 7 Region: 138-284
Classification Level Classification E-value
Superfamily CalX-like 1.44e-26
Family CalX-beta domain 0.0013
Further Details:      
 
Domain Number 8 Region: 2586-2702
Classification Level Classification E-value
Superfamily CalX-like 1.44e-26
Family CalX-beta domain 0.0023
Further Details:      
 
Domain Number 9 Region: 1715-1800,1828-1860
Classification Level Classification E-value
Superfamily CalX-like 5.1e-26
Family CalX-beta domain 0.00074
Further Details:      
 
Domain Number 10 Region: 4022-4177
Classification Level Classification E-value
Superfamily CalX-like 5.75e-25
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 11 Region: 4255-4397
Classification Level Classification E-value
Superfamily CalX-like 1.26e-24
Family CalX-beta domain 0.001
Further Details:      
 
Domain Number 12 Region: 4989-5157
Classification Level Classification E-value
Superfamily CalX-like 3.14e-24
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 13 Region: 1293-1491
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-23
Family Pentraxin (pentaxin) 0.07
Further Details:      
 
Domain Number 14 Region: 1976-2119
Classification Level Classification E-value
Superfamily CalX-like 2.22e-22
Family CalX-beta domain 0.0012
Further Details:      
 
Domain Number 15 Region: 4649-4766
Classification Level Classification E-value
Superfamily CalX-like 1.7e-21
Family CalX-beta domain 0.0032
Further Details:      
 
Domain Number 16 Region: 3568-3655
Classification Level Classification E-value
Superfamily CalX-like 1.57e-20
Family CalX-beta domain 0.003
Further Details:      
 
Domain Number 17 Region: 1861-1974
Classification Level Classification E-value
Superfamily CalX-like 2.88e-20
Family CalX-beta domain 0.0044
Further Details:      
 
Domain Number 18 Region: 1125-1276
Classification Level Classification E-value
Superfamily CalX-like 4.19e-20
Family CalX-beta domain 0.0042
Further Details:      
 
Domain Number 19 Region: 3082-3194
Classification Level Classification E-value
Superfamily CalX-like 5.36e-20
Family CalX-beta domain 0.0058
Further Details:      
 
Domain Number 20 Region: 409-546
Classification Level Classification E-value
Superfamily CalX-like 1.44e-19
Family CalX-beta domain 0.0032
Further Details:      
 
Domain Number 21 Region: 780-921
Classification Level Classification E-value
Superfamily CalX-like 3.14e-19
Family CalX-beta domain 0.0043
Further Details:      
 
Domain Number 22 Region: 2336-2381,2483-2562
Classification Level Classification E-value
Superfamily CalX-like 3.79e-19
Family CalX-beta domain 0.0026
Further Details:      
 
Domain Number 23 Region: 5119-5277
Classification Level Classification E-value
Superfamily CalX-like 1.31e-18
Family CalX-beta domain 0.0023
Further Details:      
 
Domain Number 24 Region: 1574-1690
Classification Level Classification E-value
Superfamily CalX-like 6.28e-18
Family CalX-beta domain 0.0031
Further Details:      
 
Domain Number 25 Region: 881-998
Classification Level Classification E-value
Superfamily CalX-like 1.31e-17
Family CalX-beta domain 0.005
Further Details:      
 
Domain Number 26 Region: 2810-2944
Classification Level Classification E-value
Superfamily CalX-like 1.31e-17
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 27 Region: 646-778
Classification Level Classification E-value
Superfamily CalX-like 1.57e-17
Family CalX-beta domain 0.0067
Further Details:      
 
Domain Number 28 Region: 3658-3779
Classification Level Classification E-value
Superfamily CalX-like 2.75e-16
Family CalX-beta domain 0.0077
Further Details:      
 
Domain Number 29 Region: 3763-3899
Classification Level Classification E-value
Superfamily CalX-like 3.27e-16
Family CalX-beta domain 0.003
Further Details:      
 
Domain Number 30 Region: 2709-2825
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000115
Family CalX-beta domain 0.0058
Further Details:      
 
Domain Number 31 Region: 31-150
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000017
Family CalX-beta domain 0.0016
Further Details:      
 
Domain Number 32 Region: 287-392
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000628
Family CalX-beta domain 0.011
Further Details:      
 
Domain Number 33 Region: 4160-4270
Classification Level Classification E-value
Superfamily CalX-like 0.000000000000144
Family CalX-beta domain 0.0079
Further Details:      
 
Domain Number 34 Region: 5412-5543
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000119
Family CalX-beta domain 0.0083
Further Details:      
 
Domain Number 35 Region: 5283-5410
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000693
Family CalX-beta domain 0.01
Further Details:      
 
Domain Number 36 Region: 510-622
Classification Level Classification E-value
Superfamily CalX-like 0.0000000157
Family CalX-beta domain 0.0068
Further Details:      
 
Domain Number 37 Region: 4749-4855
Classification Level Classification E-value
Superfamily CalX-like 0.000000017
Family CalX-beta domain 0.01
Further Details:      
 
Domain Number 38 Region: 1517-1594
Classification Level Classification E-value
Superfamily CalX-like 0.0000000262
Family CalX-beta domain 0.015
Further Details:      
 
Domain Number 39 Region: 4564-4637
Classification Level Classification E-value
Superfamily CalX-like 0.0000000458
Family CalX-beta domain 0.0082
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000000714
Domain Number - Region: 3198-3258
Classification Level Classification E-value
Superfamily CalX-like 0.000157
Family CalX-beta domain 0.011
Further Details:      
 
Domain Number - Region: 3366-3535
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00288
Family Galactose oxidase, central domain 0.058
Further Details:      
 
Domain Number - Region: 4896-4970
Classification Level Classification E-value
Superfamily CalX-like 0.0379
Family CalX-beta domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000714   Gene: ENSTGUG00000000694   Transcript: ENSTGUT00000000725
Sequence length 6208
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:12907368:13150984:1 gene:ENSTGUG00000000694 transcript:ENSTGUT00000000725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMPSASLLVYLLLALLIHFTSGETEVKFSGQTEFVVNETSTTVIRLVIERTGKPANITAI
VSIDGENTGDFFDTYAAAFIPDTETNRTVYISVCDDDLPEADETFTFHLTLLKPSARIRL
GAPKSVTVTILSNDNAFGIISFNMSALITVNEPRGRNEFVPLTLIRERGTYGTVVVSFEV
KDGPNSAEEDLSPARGNITFAPGTSVLIYNLTVLDDQVPENDEIFVVCLKSVEGGAEINN
TKNSVWINIRKNDSPVRFVQSAYMVPEEDEVITIQVLRGKDVTGKLIGPDEDEVSVSYAI
ITGDSTAHAQLNVDFLDLQPNTTLVFPPLVHKIYLKFKILDDAIPEIAETFQIMLLKDTL
QGDAVLIYPSVVHVTIQPNDKPYGVLSIHSVLFAHTVIIDEDQISSSEFEGITIVRNGGT
HGNVSVSWIIIRNSSDPSPVTADLLPEAGEINFDQGEMLVTLHLNIIDDDTPEEAEPYLL
KLLPHTIQGGAEVSEPSELLFYIQDSDDVYGLIKFHPLENQKIESNPTGRFLSLSFAREG
GTVGDVQLVYTTLYIPAGALDPERAKGGILNMSRRSTLIFPEGKAQATINIPIRNDAFLQ
NGAHFVIQLEKVELLNRIPLVPPISPRLGEMRNISLRITPDIANGEIGFTSNLPIIVSEP
EEFPATVVSIALHRDGTDGQATVFWSLRPSGPNKQSVTQDDISPFNGSVVFLSGQSDTAI
NITIKADDIPEMNETVLLTLDRVSVENHILKYGFTTCEITILENDDPGGVFEFSPSSRGP
YSIKEGDSVELQIVRSRGNLVRQFLRYTVEPRDNNEFYGSTGILEFKPGEREIIITLLTR
MDGIPELDEAYAVVLSGYSEMSGKLGNATRVNITILKNDDPHGVIQFLPDELSVTIKESK
GEIIYTASYRLVRKQGNYGNVSVSWIVDPVCTNDIYPEQGTIFFDNLEFSKNITIYSLPD
EIPEEMEVFIIRLFNATGGARLGNITSAFLQITRNDDPIYFAEPLTVSITEGNAANFTVL
RNGSADTVVAVQYITVNGDATAEEGDFVPSEKESFILFDVGEREQTLSVCVNDDDTPETD
EVFYIFLLNSTGDTVIFNAGVATVIIEANDDPNGIFSLEPTEKLVEEGKSNFFLILRHRG
HFGNVSLTWQLFHNGSTLKPGEEFCETYGTVYFMDGEGSKQIVLHAVSDKIPEFNEFYIL
KLVNVSGGSPGPGGQLSETSLAVTVMIPFNDDPFGVFVLDPESQDREIVEDVLSEDDLSY
ITDFTIWRHQGTFGAVRLGWEILSSTFQGGLPSMVDLLLLGSFPSSVQSQPHMRRHHSGT
DALYFSGKEDAFGIISLEYPYEGNTAVTNFTFSAWLIPNVNTDGYIVEKDDGNGTLYYGV
KIQTNDSHISVVLHYTALGSYITYIAKAAVLKYLDESTWVHILITLDESIIEFYMDGIPV
LGGIKSLKGEAIADGPGIVRIGAGINGSSRYTGFMQDVRLYERKTQAEIYELHATPRSDI
HPVSGFEYHQRETINHFIDDKEEEGEELFILKLISVCGGARISEENTTARLRIQKSDNAN
GLFGFTGACIPEAADEGSTISCVVERTRGALDYVYINYIISQVDSRGINYSVSDFSNSSG
TITFLPWQRSEVLNLHVIDDDIPELNEYFRVTLVSAVSGDGKLGSTPTSGASIDPEKETT
DISIKASDHPYGLLQFSVGPPPQPGDEMILPASAVPHITVKEEVGHIRLLVVRAQGLLGT
VLMEYRTVPLTAFSPKDYQAVWGSMEFQPGERYKYITVNITDNSIPELEKTFKVELLNPE
GGVAELFRNDGSGSGDGNMDFFLSTVPQHASLGIASHILVTIEASDDAHGVFEFSAESLS
VNGTEPEDGDSNVVLQVVRSHGTLSKVTLHWIIICDLTNDLISTVGNVTFDVGQVRANIT
LQVSPDDVPELDKMFSVLIINVSLGRLGYHTNATLTILANDDPYGVFIFSERNRPIKVEE
KTKNVSLTIVRCGGLLGTVMVKYRTIGDEEKLPFFPPDVVRAIEGKDYIPVTGYVIFATN
ESEATVSLPILDDDDPERSESVFVELSSVVLIKKVQDRPIINSPRLGLVGETIAHVIINA
NDDAFGTLQLSASAVRVAENYVGPIINVTRTGGIFSDVSVKFKAMPITATAGEDYSVASS
DVVLLEGETSKAVPIYIINDINPELEESFYVQLLNQTTGGALLGSLTRAVITIEASDDPF
GCFVFQNTEFTVEEPEFGSVAINLPIIRNAGTLGNVTVQWAATINGYPADDDLKAAMGNI
TFAPGETIQMLLLEILADDTPEVEEIVHVELTQASNGGAIGLDGVANIVIPANDNPYGTV
FFHQSSYQIQEPLERNLLANISVRRSGGRFGHLQVFYSTSETDIVALAIEQGEDILAYYE
SPAQGIPDQPSKTRVNVSAASNPLYACATQCLKEQACSAFTFSSASEIPLCLWLMTEIGP
LTNMSGLWTYKKNISSTSILFSTQAIAGSDYESVTGQWAIMQEGEEFANLTVTILPDSLP
ELDEKFTVSLLKVELLNISASLKNQPTIGQPNTSTVIIMMNGDAFGVFRIYSVSPNATEN
GLYIEVEERPQASVQLMIHRTEGSLGQVAVEWRVVGGTATPNLDFVGVGEILVFAEGETR
KMVTLTILDDPEPEDDESIIISLVHTEGGSRILPSFNTVTVVILASDNVAGIISFQTAGR
SVIGHEGEKLQFHVVRTAPGLGNVTVEWKIVGHNIQQNFEYSSGILFFPEGILNTTLYVH
LLDDHIPEDKEEYRIILYNIKTEGVSPSGAAVLDSQGYEAILTVEASDEPHGVLNFASPS
RVVLLPEENKTVQLFINREFGSLGVINVTYATVPGLVSLSNQTEGTLAEPGADYVAVSDS
VILKEGETSAAINVTILEDDVPEVQEFFLVNLTSVELIMNHSTSSPPRLDVEGLASQIII
DANDGVSGVVEWERSNFEVNETHGNLTIMAYRNKGSYGSVSVFFYAQNLEAQLGLDFNVV
SRTLFFADGETNKSVVVVIYDDDIPEGVERFQLILTNPSFGLELGENTTATITIFANDDG
HGILSFNNSDHIFLREQTALHVMESVAVLNIIREPPQGIFGTVSVQYLVSEINSSEPSVD
LAPSQGYVVLEEGVRFKTLHISAILDEEPELDEHFIVTLFNPTGGARLGTRVQTMITILQ
NQAPLGLFSIYPVTNRTNIFTVEEANTTVYLKVSRSNGLNVSVSVEWETLSDTAFGIRDG
ISVLSVVQSFAEESAASWCFFALEKNLYGVLLRSPPAVFSTLYQWKGVFVAIENFSMWNP
KSCVSFQIHASPYVVITHGGGSRGASNTSVFALMPGRKLLKLQTLSILDTTLVKHFAVGE
EDYLVFVSDNTSFSSIQVFQWNKDIFVLHHQLPLYRALNIALFPRGGIMYLVVSLSNTSQ
NVLLYQWLNNEFRNLHQLPAKEVKDMEAWTSGSDIYLIVAKDTITETGNCEILIWETGKS
SFRHFQSLPVSAVRNIHVFMPPSGLVHILLSGKDTTTLYSWNSEGNQFSLVLQAPYADHI
TSTTARSLNSSKSLIALSVESSSKIYELTTISNQSDFIPSSGELTFEPGDMDAVIAVNIL
DDIIPEEEECFKVRLKNPKGGAEIGVHSFVNIIIPPNDNAYGVIAFAQNSLFKQIEEMEQ
DSLITLNIERLIGTYGRVAVEWITNGSISDVFPASGMVTFSEGQALSTITLTILADSVAE
PSEAVEVILTCVTTVDVQDATKGAIIDPKRARAVLSILPSDSPHGVIQWHRESLFVKITE
PEGQDNSTTVTLQIVREQGFVGDLAVQLSTAPNFELPPSNRATENEDYILEKKTVILAEN
ATTTSVIVTILPDNIPELQEGFIINITDVQLITSSEGQPSVKRLGLEIAEITIEENDDAR
GIFNFNVTKGITGAVSGYEVPPPQNVLKLPVVRQAGRFGSATLYWEAIPSTASFEDFTPS
SGNLTFADGQATGEIEITIIDDSEVELLEIFKIVLVRVTDGARLGNDTLVTVAIPPNDSP
VGVFRFEEKNVTVKEPQTPDDSAAIVLLNVSRSQGGRGEVTVVWILEEAAKYDLTPLNGT
LHFSETESQKLIILHAIQDGLLEGNETFTVQLVSTGDAEISPVNGVATITIMGDEGASGV
VGIAHSSKHVLIGEPSGSYNGTALISLVRGPGIFGEIIIYWNITPPHQTEFIEVSGTLTM
RDRQSAAVVLIQAVDDNYPEEKHYYQFQLTRVSDGGLINESSSTANITMAASDYPFGEFS
FSHELLLTTEDEKWVNITVVRSKGSYGRVRLCFQIINGTAEEGIDFTPTVREVMFEPAEE
SKIMLIEIHDDDFPEGPENFSLIITEVELQGSGFDFTVRENGLQVDQPPVIGNISTVWIT
IAKNDNAEGIIEFDPKHVLLQVEEDAGLIMIPVLRKCGTYGNVMADFLSRSISALHGVDY
IIHNNTVVFYNGQNQSFIYISIINDEESELAEQFEIQLTGATGGAILGLHLVSQVTIAKS
DSSQGMVRFLNQSQITLPNPDATTTVSLVVERTGQLVEAQINWDILGPNSEEILSPLNSD
IGDPVNGTLYFEEGEGGLRTINLQIYPHEEVEVQETFIIRLSLRKGETEIDPKANSITLI
IEKFGDPNGIVQFAPESLTESNYEEPSGDKGPQNITLFVKRIQGILGNIMVYWEIRSNSD
ITGDFLETEGFVVIADQQSTAEIIIYLLPDDVPELDESYEVHLISVEGGADLDHEKAISR
ITVFANDDPYGVFALYSDQQSVLVEKTLDRYVQINVTRHAGLFGDVMVEYHVISLHDEVV
IEPENAVGFLTIKDGASFGVKRVPISNQAFILLGLNFTLELTNVSLVRGSAKDVPKILGI
AKSAVLLIPAEAANSQVGFESVILRLTNVVAGTGHAVITRRGVYGSVIVSWISGCPPDLV
TDSVKPGNITPSFGTIVFSSGEESKVISFQAIPSINKSETFAIILTAVHSNVSGGARLRS
GFTIAKIEPMGIFQFDLNSRLVSVEEDVQVVRLHVQRLFGFQSNLTKLTYQTIPGSAKPL
EDFIPIYNGELMFLHFQTNAVIEISIIDDTVSEIQEFFFVNLTSVEILDVQPVNLDWNPR
LNPDFSVATVNILDNDIHHGVLSLGPEFIYVEEDTNNNASNTAVLQIRRTKGFTGDIKIT
VKTFGGVSAQSGVDLYPFGNIYGKSNFTWAMEGEDFEEQTISLTLLDGETESQVSIKIFD
DDEPEGQESFYVFLSNPEYGAQIVEGKDEHGFAAFAIVIIAGSDLHNGILGFIPEVQSGL
ILDEDSENREVLLTVARQPNRAFEDVTIFWRVTFNKTAVVLLKDGVNLENELVSVLGATT
CVAGQTMCNISIEIKPDHVPEFETYIFVELYAVSAGAALNNSARFAFITVLESDGPHTLV
YFAVGSRFAVAYKKTALISLQVLRDSSTPGTTMVTYSMQELQKPEPIGQTFISPAVAGQD
FARSEGLLTFERGQRSAFLDVTLTPKTGSLNPFPKRFQVVLSNPTGGARIDDVYGISNIT
IVSDLDSLPVWGLIDQLHQPLDDTILHKILQNLNVKVATEATEEQLTAVVHIVDKVADVG
EKLLLTDKSRSLFYEILCALASPKRKDTQGYSLLAELTEKFAFSLLTGLKCGSPGERGKN
ILDSCPYIAIMAHNWFPQQINGHRFSGKDGDSIQVPENLLEVSIVLSSPQEENCESIQFT
EYSSQQWFLTGDKELALKNKVFSMSLKGQSSQPLKDDSKVIYRIYAEGSRIVPQKSLCLL
WNKAAESWLSSSGFCKVVDETPAYVECSCSHMSIYAVYAQTDNLSSYNEAFFSSGFISIS
GFTLAIISHLFCTRCAMFAAKLLTHMMAACLGTQVSFLASAYMSQHISEESCIALASVTH
YLYLCQFSWMLIQAVNFWYVLVMNDEHTERRYLLYFILSWGLPAFVVILLLITLRGIYHH
STAQIYGLVYSDLCFIPNAYAALFTAALVPLMCLVVVFVVFIHAYQVTPQWKAYDDIFRG
RTNAAEIPLVLYLFALISITWLWGGLHMAYRHLWMLVFFIIFNSLQGLYVFVVYFILHNQ
LCCPVKASYTVDMNGHTTPGSAFFTHGSGLPAAGGEISKSTQNLISAMEEVPAEWERASL
QPASQASAAFKQSPQNGNVFHPSGGFSTSSLVADEESQEFDDLIFALKTGAGLSVSDNES
CHGSQDGGSMANSQIVELRRIPIADTHL
Download sequence
Identical sequences H0YR07
ENSTGUP00000000714 59729.ENSTGUP00000000714 ENSTGUP00000000714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]