SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000755 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000755
Domain Number 1 Region: 6-70
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000118
Family Growth factor receptor domain 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000000755
Domain Number - Region: 169-214
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00178
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Domain Number - Region: 67-120
Classification Level Classification E-value
Superfamily FnI-like domain 0.0167
Family Fibronectin type I module 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000755   Gene: ENSTGUG00000000743   Transcript: ENSTGUT00000000766
Sequence length 319
Comment pep:novel chromosome:taeGut3.2.4:23:150416:157739:1 gene:ENSTGUG00000000743 transcript:ENSTGUT00000000766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QACTFPCQCPSQPLQCPAGTSHVWDVCGCCKVCAQQLGELCSLHRPCGHHKGLYCDFSKI
HRGSGICLAHEGAACDLLGKMYLNGESFQPTCKLQCICMDGAIGCIPLCSDDLRLPSPEC
PKPRRVKFHNKRCEEWVCEEGSEDNRFGTAMAVFREDPAHEPELNNLQENCLVQTTEWSM
CSQSCGMGISTRVTNDKPQCCLEKETWLCMVRPCNFSMEKTKKGKKCVQTPKQRQSLHFE
FSGCTSTRSYWPRFCGSCLDGCCCTLFLTSTMDVEFHCPGDFFQRKVMFIKMCSCLYDCP
RDNDIFLATYHHWMIGDHV
Download sequence
Identical sequences H0YR47
ENSTGUP00000000755 59729.ENSTGUP00000000755 ENSTGUP00000000755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]