SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000769 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000769
Domain Number 1 Region: 396-538
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-38
Family Third domain of FERM 0.00000434
Further Details:      
 
Domain Number 2 Region: 292-397
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-36
Family Second domain of FERM 0.00000122
Further Details:      
 
Domain Number 3 Region: 211-291
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.79e-26
Family First domain of FERM 0.000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000769   Gene: ENSTGUG00000000745   Transcript: ENSTGUT00000000780
Sequence length 865
Comment pep:known_by_projection chromosome:taeGut3.2.4:23:202102:249963:1 gene:ENSTGUG00000000745 transcript:ENSTGUT00000000780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEKSPAANADNSEQQQAKEEEGAAETKKQKASLEEGAQPTPERQPQRQKSSNGDTPTH
EEQGKKERRTSEGRGFSRLFSSFLRRPKSQVSEEDKDTDAPKEAGGDQKDAGLGVGPDED
ILVKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEERRDDQEPERRDFEDREEGEAKEEG
AKPELKPESLETRADKDLKAAQKVVKRHRSMYCKVVLLDDTIFECSMDKHAKGQDLLKKV
CDHLNLLEEDYFGLATWDTPTSRTWLDPAKEVKKQVHGGPWDFTFNVKFYPPDPAQLTED
ITRYYLCLQLRQDILTGRLPCSFATLALLGSYTVQSELGDYDPDLHGPDYISEFKLAPNQ
TKELEEKVVELHKTYRSMTPAQADLEFLENAKKLSMYGVDLHQAKDLEGVDITLGVCSSG
LLVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEQYESTIGFKLPSYRAAKKLWKV
CVEHHTFFRLTSTEAIPKSRFLALGSKFRYSGRTQAQTRQASALIDRPAPQFERTASKRV
SRSLDGAVAVITPERSPRPTSAPAIAQNHPAEPAPAKSNVKDMATSKVGKETAKSDGRRE
EYPLEKPEEPVDASKVRKTHIEVTVPTMNGAQPQQPAEKEEELIRMRKKRSKRLDGENIY
IRHSNLMLEDLDKTQEEIKKHHANISELKKNFMESVPEPRPSEWDKRLSTHSPFRSLNVN
GQIPTGADGPPLVKTQTVTISDVSSAVKSEIPTKEVPIVHTETKTITYEAAQTDGGNGDL
DPGILLTAQTITSETTSSTTTTQITKTVKGGISETRIEKRIVITGDADVDHDQVLAQAIK
AAKEQHPDMSVTKVVVHQETEIAEE
Download sequence
Identical sequences H0YR61
ENSTGUP00000000769 59729.ENSTGUP00000000769 ENSTGUP00000000769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]