SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000813 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000813
Domain Number 1 Region: 866-1168
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.78e-93
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000498
Further Details:      
 
Domain Number 2 Region: 1127-1431
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.1e-78
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000128
Further Details:      
 
Domain Number 3 Region: 23-184
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-38
Family MAM domain 0.00000838
Further Details:      
 
Domain Number 4 Region: 384-587
Classification Level Classification E-value
Superfamily Fibronectin type III 7.98e-27
Family Fibronectin type III 0.00087
Further Details:      
 
Domain Number 5 Region: 282-412
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000929
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 6 Region: 187-290
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000229
Family I set domains 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000813   Gene: ENSTGUG00000000777   Transcript: ENSTGUT00000000824
Sequence length 1433
Comment pep:known_by_projection chromosome:taeGut3.2.4:23:384499:426226:1 gene:ENSTGUG00000000777 transcript:ENSTGUT00000000824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTSCACCLHLRTRSCWADRSVPTAGCTFEEDSDPNQCEYSQGEDDDFDWELIRSYLMPHL
MPDLPHGSYLMVNSSQHTPGQKAHLLFQALSENDTHCLQFSYFMFSRDGHSPGTLSAYVW
VTGGLVGSAVWNASGSHGRQWHQAELAVSLFWPSEYQVLFEAVVSSERRGYLGLDDILLL
NYPCSKAPHFSRLGDVEVNAGQNATFQCVAAGKAAEAERFLMQRQNGEVVPAASVKHISH
RRFLATFQLDAVSKEEQDLYRCVTQSTRGAGVSNFAELIVKEPPTPIAPPQLLRAGSTYL
IIQLNTNSIIGDGPIVRKEIEYRMTSGPWSEVHAVNMQTYKLWHLDPDTEYEISVLLTRP
GEGGTGKPGPPLISRTKCAEPMRAPKGLAFSEIQSRQLTLQWEPLGYNLTRCHTYTMSLC
YRYFVGSGHNQTFQECVKMERNTNRYTIKNLLPYKNIHVKLILSNPEGRKEGKEAIFQTD
EDVPGGIASESLTFTPLEDMIFLKWEEPVEPNGLITQYEISYQSIESSDPAVNVPGPRRT
VSKLRNETYHVFSNLHPGTTYLFSVRARTGKGFGQTALTEITTNISAPTFDYGDMPSPLS
ESESTITVLLRPAQGRGAPISTYQVIVEEDRPKKLKRELGGQECFPVPLTFDDAMSRGSV
HYFGAELPASSLTEAKPFTVGDNHTYSGYWNPPLEPKKAYLIYFQAMSNLKGETRLNCVR
IARKAACKESKRPLEVSQHSEEMGLILGICAGGLIILIILLGAIIIAIRKGKPVNMTKAT
INYRHEKTHMMSAIDRSFTDQSTLQEDERLGLSFMDTHGYGNRGDQRSSVVNESSSLLGG
SPRRQCGRKGSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYESFFEGWDASKKKD
KTKGRQDHVSTYDRHRVKLHPLLGDPNSDYINANYIDGYHRSNHFIATQGPKQDMVYDFW
RMVWQEHCSSIVMITKLVEVGRVKCSKYWPDDSEMYGDIKITLVESETLAEYAVRTFALE
RRGYSARHEVKQFHFMSWPEHGVPYHATGLLAFIRRVKASTPPDAGPIVIHCSAGTGRTG
CYIVLDVMLDMAECEGVVDIYNCVKTLCSRRINMIQTEEQYIFIHDAILEACLCGETSIP
ACEFKPTYKEMVRIEPQSNSSQLREEFQTLNSVTPHLDVEECSIALLPRNRERNRSMDVL
PPDRCLPFLISVDGDSNNYINAALTDSYTKSAAFIVTLHPLQNTTTDFWRLVYDYGCTSI
VMLNQLNQSNSAWPCLQYWPEPGLQQYGPMEVEYISGVADEDIVSRLFRVQNITRLQEGH
LMVRHFQYLRWSAYRDTPDSKKSFLHLLAQVERWQKESGDGRTVVHCLNGGGRSGTFCAS
TMILEMIKCHNMADVFFAAKTLRNYKPNMVETLEQYHFCYDIALEYLESLETR
Download sequence
Identical sequences H0YRA4
ENSTGUP00000000813 59729.ENSTGUP00000000813 ENSTGUP00000000813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]