SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000834 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000834
Domain Number 1 Region: 102-226
Classification Level Classification E-value
Superfamily PUG domain-like 1.96e-28
Family PUG domain 0.003
Further Details:      
 
Domain Number 2 Region: 256-360
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.53e-16
Family UBX domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000834   Gene: ENSTGUG00000000813   Transcript: ENSTGUT00000000845
Sequence length 393
Comment pep:known_by_projection chromosome:taeGut3.2.4:28:3925742:3929568:1 gene:ENSTGUG00000000813 transcript:ENSTGUT00000000845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPRQAPTDEAQKAAAAALARLELKLKGKAPSASQEHIKNQVRKELMAEAAAGEKGLSMEE
KQEEEGAAAPSVSGVYFICPLTGAVVRKDQKEKQLREAIQAYSSVDPVAASIMEIHTFNK
DREKVRLCVETMAKYLDNIYLHPEEEKYRKIKLQNKVFQERISCLEGTHKFFQAVGFETK
TLPVPGQGLVEFYVLQEEVLSRLEGLKEHKEQLLSSEPVRAQLHRQLALFRPSPAAARFE
LPHDFFNLTAEELRREQRLRTEAVEKASMLRTRAMREKDEQREMRKYNYTLLRVRFPDGY
ILQGTFYARESVSVLYNFVREALRDDWLPFELLGPGGLKLTDENLAFNECGLVPSALLSL
AWDAAVMADVEAAAEEQRSPLRPELLARAQTLS
Download sequence
Identical sequences H0YRC5
ENSTGUP00000000834 ENSTGUP00000000834 59729.ENSTGUP00000000834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]