SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000874 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000874
Domain Number 1 Region: 85-413
Classification Level Classification E-value
Superfamily Subtilisin-like 1.96e-73
Family Subtilases 0.00000000256
Further Details:      
 
Domain Number 2 Region: 408-526
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.65e-32
Family Proprotein convertase P-domain 0.0000452
Further Details:      
 
Domain Number 3 Region: 2-73
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 5.27e-17
Family Prohormone convertase 1 pro-domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000874   Gene: ENSTGUG00000000849   Transcript: ENSTGUT00000000885
Sequence length 530
Comment pep:known_by_projection chromosome:taeGut3.2.4:28:4059367:4063775:-1 gene:ENSTGUG00000000849 transcript:ENSTGUT00000000885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYLSSWAVRVAAGRRDARALARRHGLLYLGQVMEGEPFHHFSHRGGRQRALSRHWGWHMR
LTRDPQVLWFEQQTLKRRAKRGTGVVPTDPWFPKQWYMVRPGCFPSSSPPQSWEEGAGTS
SPLPAQQHPGAQELVWRGADPLASYDFNSNDPDPQPRYSNSDKNWHGTRCAGEVAAVANN
GICGAGVAYNAKIGGVRMLDGSITDMVEAQALSLQPQHIHIYSASWGPEDDGRTVDGPGV
LAAAAFHRGVIQGRGGLGSIFIWASGNGGTNYDNCNCDGYTNSIYTVSVGSVLGDGQRPR
YGESCPAILTTTYSSRSSSEVQMVTTDLHHRCTDKHTGTSASAPLAAGMVALALEANPAL
SWRDLQHLIIRASRPAHLQAEDWAENGAGRRVSHYYGYGLLDAGLLVQAASMWTGTRPQE
KCSIQAVQVPRDIGSRLTISTDASSCSKSIRSLEHVQVQLSLSYSRRGDLLVALSSPMGT
KSTLVTVRPYDTSQDGYKDWTFMSTHFWDENPKGIWTLQLENRGDAQNTG
Download sequence
Identical sequences H0YRG5
ENSTGUP00000000874 ENSTGUP00000000874 59729.ENSTGUP00000000874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]