SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000879 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000879
Domain Number 1 Region: 2-65
Classification Level Classification E-value
Superfamily Homeodomain-like 3.55e-27
Family Homeodomain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000879   Gene: ENSTGUG00000000860   Transcript: ENSTGUT00000000890
Sequence length 72
Comment pep:known_by_projection chromosome:taeGut3.2.4:26:81195:82458:-1 gene:ENSTGUG00000000860 transcript:ENSTGUT00000000890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWR
KRERYGKIQEVR
Download sequence
Identical sequences A0A087QMY0 H0YRH0
59729.ENSTGUP00000000879 ENSTGUP00000000879 ENSTGUP00000000879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]