SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000911 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000911
Domain Number 1 Region: 499-658
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-43
Family MAM domain 0.00056
Further Details:      
 
Domain Number 2 Region: 330-490
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.22e-31
Family MAM domain 0.0012
Further Details:      
 
Domain Number 3 Region: 160-320
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.27e-28
Family MAM domain 0.0022
Further Details:      
 
Domain Number 4 Region: 17-160
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.8e-18
Family MAM domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000911   Gene: ENSTGUG00000000888   Transcript: ENSTGUT00000000922
Sequence length 679
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:17105263:17161178:-1 gene:ENSTGUG00000000888 transcript:ENSTGUT00000000922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVFVLAALRLAGAALLAPGSCTFEDSACGYQWDYAHLPWTLHGEGHYISVDTSYEGEKAV
LSSPDLYSEEWSCVRLIYQIATTSDASPDPARLNLYLRQEGESFDRLLWSTSEPSDSWLI
ASLDLTNGTNKYKLVLEGEMRQDKSASIAVFEIKITSGYCIECDFEENHLCGYVNRWNPN
VNWFVGGGNIRNSQSILPKDHTLNSALGHYMYVDSVYVKDFQEVAQLISPKTTVPISGCL
SFYYQLKQESSIVFTVYLRDMSGFYEEIWKTDSALNADWALAEVDFNAPYPMEVIFEVAF
NSAKGGYVALDDISFSPVYCSNQTGATFNPANAGCNFEEDLCNFYQDHKDGPGWSRVKVK
RNVYRAGDHTTGFGYYLLANTKFTSQPGYIGRLYGPTLPGNLQFCLRFYYALYGFFKMSG
ILAVYIFEENHVVQEKIWSVLDSPKGVWTQAEISFKKPMPCKVVFVSWCKSFWDCGLVAL
DDVSLSLGSCQAADLLLPTPGECTFEKDECMFTQKKRGRGSWHRKRGPTPTSYTGPKGDH
TTGVGYYMYIEASNMVYGQRAYLVSRSLRGTSGKQCLTFFYHMYGAGTGLLSVYLKKEGD
DEEIPLWRRTGEQSISWLRGLIEYESDTNYQIIFEAIRGVSIRSDTAIDDILFQAGPCLE
VEEIQFSSGYPDSLNEIEY
Download sequence
Identical sequences H0YRK2
59729.ENSTGUP00000000911 ENSTGUP00000000911 ENSTGUP00000000911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]