SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000988 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000988
Domain Number 1 Region: 426-583
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000000186
Further Details:      
 
Domain Number 2 Region: 272-422
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.77e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000000236
Further Details:      
 
Domain Number 3 Region: 643-798
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-33
Family MAM domain 0.001
Further Details:      
 
Domain Number 4 Region: 144-261
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-32
Family Spermadhesin, CUB domain 0.00000144
Further Details:      
 
Domain Number 5 Region: 24-139
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-32
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000988   Gene: ENSTGUG00000000947   Transcript: ENSTGUT00000001000
Sequence length 917
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:15289164:15401337:1 gene:ENSTGUG00000000947 transcript:ENSTGUT00000001000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWGLLLHCAALTFTLARALRSDKCGDTIKILSPGYLTSPGYPQSYHPSQKCEWMIQAPE
PYQRIMINFNPHFDLEDRDCKYDYVEVIDGDNAEGRLWGKYCGKIAPPPLVSSGPYLFIK
FVSDYETHGAGFSIRYEVFKRGPECSRNFTSSSGVIKSPGFPEKYPNSLECTYIIFAPKM
SEIILEFESFELEPDSNTPGGAFCRYDRLEIWDGFPDVGPHIGRYCGQNNPGRVRSSTGI
LSMVFYTDSAIAKEGFSANYSVSQSSVSEDFQCMEPLGMESGEIHSDQITVSSQYSAMWS
SERSRLNYPENGWTPGEDSIREWIQVDLGLLRFVSGIGTQGAISKETKKEYYLKTYRVDV
SSNGEDWITLKEGNKPVVFQGNSNPTDVVYRAFAKPVLTRFVRIRPVSWEKGVSLRFEVY
GCRITDYPCSGMLGMVSGLIPDSQITASTQVDRNWIPENARLITSRSGWALPPTTHPYTN
EWLQIDLGEEKIVRGIIVQGGKHRENKVFMKKFKIGYSNNGSDWKMIMDSSKKKIKTFEG
NTNYDTPELRTFEPVSTRFIRVYPERATHGGLGLRMELLGCELEAPTAVPTVSEGKPVDE
CDDDQANCHSGTGDDYQLTGGTTVLNTEKPTVIDNTLQPEPPLYNCAFGWGSQKTLCHWE
HDNQVDLRWAILTSKTGPIQDHSGDGNFIYSQADESQKGKVARLLSPVIYSQNSAHCMTF
WYHMSGAHVGTLKIKLRYQKPDEYDQVLWTLSGHQANYWKEGRVLLHKSVKHYQVVIEGE
IGKGTGGIAVDDIKIDNHIAQEDCRIVTKISSEKFAILYSISGFTPPYRTGDDYDDISRK
PGNVLKTLDPILITIIAMSALGVLLGAICGVVLYCACWHNGMSERNLSALENYNFELVDG
VKLKKDKLNTQNSYSEA
Download sequence
Identical sequences H0YRS9
ENSTGUP00000000988 59729.ENSTGUP00000000988 ENSTGUP00000000988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]