SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001036 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001036
Domain Number 1 Region: 77-182
Classification Level Classification E-value
Superfamily Second domain of FERM 8.64e-37
Family Second domain of FERM 0.000044
Further Details:      
 
Domain Number 2 Region: 180-327
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-36
Family Third domain of FERM 0.00068
Further Details:      
 
Domain Number 3 Region: 6-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.58e-17
Family First domain of FERM 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001036   Gene: ENSTGUG00000001008   Transcript: ENSTGUT00000001048
Sequence length 657
Comment pep:novel chromosome:taeGut3.2.4:Z:20957250:21030350:-1 gene:ENSTGUG00000001008 transcript:ENSTGUT00000001048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCCFCQGKKSTKGSVVLGYVFRHLNLVEIDYFGLRYCDRSHQTYWLDPAKTLAEHKELI
NTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPINTAAQLGAYIIQ
SELGDYDPYKHTAGYVSEYRFVPDQKEELEDAIERIHKTLMGQVPAEAEVNYLGVAKSLE
MYGVDLHPVYGENKSEYFLGLTPIGVVVYKNKKQVGKYFWPRITKVHFKETQFELRVLGK
DCNETSFFFEARNKVTCKHLWKCCVEHHTFFRVPENESNSLSRKISKFGSIGYKHRYSGK
TSLRMTRDPSVQLPRPDQSIERSRSKTYPKRTQQTGSKNMSQITTNGENEGTTKIIAPSP
VKSFKKMKNENSPETQRSKTSAPWEENGPQRSGLYNSASDRNKSPKFPYSRRRNPSGGSE
NESGQPVRRRKNQNSGEDSDLKQRRRSRSRCNTSSGSESENSNREHRKKRNRLRQENDMV
DSAPQWEAVLRRQKGKTQADPNYRRSRHRSRSRSPDVQAKEELWKHIQKELVDPSGLSEE
QLKEIPYTKVETQGDPIRIRHSHSPRSYRQYRRSQCSDGERSVLSEVNVKTDLVPPLPIT
RSSDGKVPSIQMTQQRQNGSKDGLIEETPLLSTNNVDGKPNTKIVKTVQVSRFKVET
Download sequence
Identical sequences H0YRX6
ENSTGUP00000001036 ENSTGUP00000001036 59729.ENSTGUP00000001036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]