SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001055 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001055
Domain Number 1 Region: 46-103
Classification Level Classification E-value
Superfamily RING/U-box 3.77e-19
Family ZZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 323-371
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000245
Family UBA domain 0.00024
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000001055
Domain Number - Region: 1-33
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000834
Family PB1 domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001055   Gene: ENSTGUG00000001022   Transcript: ENSTGUT00000001067
Sequence length 376
Comment pep:novel chromosome:taeGut3.2.4:13:7201482:7205874:-1 gene:ENSTGUG00000001022 transcript:ENSTGUT00000001067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDGDLIAFSTDEELEMAMPYVRDGVFRVYIKEKKECKREHRSQCSQEPPRNMVHPNVICD
GCEGPVVGTRFKCSVCPDYDLCSTCEAKGIHKEHNMVMFQSPLLNPFEWLPRGRWLRKMR
HGVPPFPWMHCWGYPGPAAPCQNSEQAEATAAAPSAPAAEAPPQDPNVTFLKNVGESVAA
FLSPLGIEVDIDVEHGGQRSKVTPTSANQEKTSAEAASSAPTQNVQTKADWINVIAEQMQ
DMVVDSVPTQMEDGSFHSQEHSESSSSSGGEEDWTHLSSKEVDPSTGELQSLQMPDTDGP
SSLDVPRDRPTGLREAALYPHLPPEAEPRLIESLSQMLSMGFSDEGGWLTQLLQIKNCDI
GAALDAIQYSKQPPHL
Download sequence
Identical sequences H0YRZ5
59729.ENSTGUP00000001055 ENSTGUP00000001055 ENSTGUP00000001055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]