SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001074 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001074
Domain Number 1 Region: 84-156
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.32e-18
Family Complement control module/SCR domain 0.00056
Further Details:      
 
Domain Number 2 Region: 145-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000162
Family Complement control module/SCR domain 0.00017
Further Details:      
 
Domain Number 3 Region: 468-539
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000181
Family Complement control module/SCR domain 0.00057
Further Details:      
 
Domain Number 4 Region: 529-594
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000653
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 277-345
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000181
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 6 Region: 213-278
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000375
Family Complement control module/SCR domain 0.0007
Further Details:      
 
Domain Number 7 Region: 410-474
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000834
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 8 Region: 337-406
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000153
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 9 Region: 40-94
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000639
Family Complement control module/SCR domain 0.0034
Further Details:      
 
Domain Number 10 Region: 585-648
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000877
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001074   Gene: ENSTGUG00000001042   Transcript: ENSTGUT00000001086
Sequence length 692
Comment pep:novel chromosome:taeGut3.2.4:26:978958:995985:-1 gene:ENSTGUG00000001042 transcript:ENSTGUT00000001086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAVLGSLLTAALVVAVHSQCAAPPRSPSAEPKERLEGHQLFPSGYRMAFVCRPGFGRNTR
TSNVLVCGVNGVWHGSSEICIPKACSYPGEPANGRLVLPGVFTFGSKVNFTCNTGYRLIG
HSEIECVLRNEVLTWSSDVPICQAIPCAPPPEIANGQHSGMDKEHFEYGDSVTYQCHRSR
RGVRPFSLVGEASIFCTSLDNLNGVWSSPAPECKVVTCKQPRVENGKLLSGYRPEYSFGD
TVVFDCDFRHSLSGSGASSCRDSGLWEPPLPLCQRSSCDDPPDVRNAMKTRLAGNLFPVG
TVVTYECQQGHQFRAGETTWNISCLQDFVWSEPPPPCERIPCPDPDIPNGKPLHPWQVKE
VYESGDRLEVECSEGFAFKGHGSGSSITLRCGNDGGWDPAVPECIPEPHCPKPSILHGKE
VYKSRSGYTVGTRVRLACEEGFALRGLETITCGADLSWEPVMPFCDKVCGPPPQIPFGQH
SGRGATGFPYGTKVTYSCAEGLSLIGDESLHCTSEDGENLTWSGPAPECRVVRCPRPVVE
RGRMTPQTFTFPYGLLLHFSCDQGFRLHGAAQSQCLADGAWHPPLPTCQPVQCPSLPRRD
DVVVDFNQLWYEVNATVTFSCKSDGRNGALSKTTCSADGTWTPPPTCRKSDVCERVLRNK
AAFRCGIPLSDLKTQLEVQKLLLEIQKLEKEL
Download sequence
Identical sequences H0YS14
ENSTGUP00000001074 59729.ENSTGUP00000001074 ENSTGUP00000001074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]