SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001080 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001080
Domain Number 1 Region: 46-110
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.29e-20
Family HkH motif-containing C2H2 finger 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001080   Gene: ENSTGUG00000001050   Transcript: ENSTGUT00000001092
Sequence length 133
Comment pep:known_by_projection chromosome:taeGut3.2.4:23:3021398:3022683:-1 gene:ENSTGUG00000001050 transcript:ENSTGUT00000001092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPRNGWGTGAHRFHSFALQLKTKRRRRDLNEIHADLKPENAARLLRQEIDPDLPGCAQF
YCLHCARYFVDLNSMKEHFRSKVHKKRLKQLREAPYTQEEAERAAGMGSYVPPKKVEVQT
QPLEEVTEMETSG
Download sequence
Identical sequences H0YS20
ENSTGUP00000001080 ENSTGUP00000001080 XP_002195157.1.42559 59729.ENSTGUP00000001080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]