SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001139 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001139
Domain Number 1 Region: 132-206
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000517
Family Ras-binding domain, RBD 0.04
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000001139
Domain Number - Region: 2-23
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00942
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001139   Gene: ENSTGUG00000001106   Transcript: ENSTGUT00000001151
Sequence length 262
Comment pep:known_by_projection chromosome:taeGut3.2.4:26:1192018:1198696:-1 gene:ENSTGUG00000001106 transcript:ENSTGUT00000001151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADCRYTCHQECRSLIQLDCPQGQLSPESTLVPPCSQNVAQTVEEEKPEPPTVQEIKEKIE
KYNAKVTNCLLMKLNDDGTYTGFIKVHLKLRRPVTVPAGIRPPSIYDALKEVNLAEMTDK
RTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKEMRKDGQVLFQKLP
LTEYPLYLRLLAGPDTDVLSFVLKENETGEVEWDAFSIPELQNFLMILDKEEKDKIQQVH
RKYERFKQRLQQTLKEARGKPG
Download sequence
Identical sequences H0YS79
ENSTGUP00000001139 ENSTGUP00000001139 59729.ENSTGUP00000001139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]