SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001158 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001158
Domain Number 1 Region: 189-429,457-539
Classification Level Classification E-value
Superfamily DNase I-like 3.66e-36
Family DNase I-like 0.06
Further Details:      
 
Domain Number 2 Region: 41-146
Classification Level Classification E-value
Superfamily L domain-like 1.25e-24
Family Internalin LRR domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001158   Gene: ENSTGUG00000001119   Transcript: ENSTGUT00000001170
Sequence length 556
Comment pep:known_by_projection chromosome:taeGut3.2.4:13:7682679:7697682:-1 gene:ENSTGUG00000001119 transcript:ENSTGUT00000001170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKEKYDPPDPRRMYTIMSSEEAANGKKSHWAELEISGKVRSLSSSLWTLTHLTALHLSD
NSLSRIPSDIAKLHNLVYLDLSSNKIRSLPAELGNMVSLRELHLNNNLLRVLPFELGKLF
QLQTLGLKGNPLTQDILNLYQEPDGTRRLLNYLLDNLAGTAKRISTEQPPPRSWIMLQEP
DRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKAIMQEILSCNADIISLQE
VETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTV
EFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKLIEMSSGKPHLGMEKQLVLVANAH
MHWDPDYSDVKLVQTMMFLSEVKNIIDKASRSLKPGVSGELGTIPLVLCADLNSLPDSGV
VEYLSTGGVETNHKDFKELRYNESLTNFSCNGKNGTTNGRITHGFKLKSAYENGLMPYTN
YTFDFKGIIDYIFYSKPQLNILGILGPLDHHWLIENNISGCPHPLIPSDHFSLFAQLELL
LPFLPPVNGIHLSGRR
Download sequence
Identical sequences H0YS98
59729.ENSTGUP00000001158 ENSTGUP00000001158 ENSTGUP00000001158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]