SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001165 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001165
Domain Number 1 Region: 106-249
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.98e-35
Family Glutathione S-transferase (GST), C-terminal domain 0.00000329
Further Details:      
 
Domain Number 2 Region: 31-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.03e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001165   Gene: ENSTGUG00000001132   Transcript: ENSTGUT00000001177
Sequence length 252
Comment pep:novel chromosome:taeGut3.2.4:23:3343865:3368493:-1 gene:ENSTGUG00000001132 transcript:ENSTGUT00000001177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSVPVNGLKEGDKEPVIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLK
RKPADLQNLAPGTHPPFITYNGEVRTDVNKIEEFLEDVLAPPKYLKLSPKHPESNTAGMD
IFAKFSAFIKNSRPEANEALKRGLLKTLQKLDEYLNSPLPDEIDENSLEDVTVSRKFLDG
NEMTLADCNLLPKLHIVKVVAKKYRNFEIPKEMTGIWRYLTNAYSRDEFTNTCPGDKEIE
IAYSDVAKRLTK
Download sequence
Identical sequences H0YSA5
ENSTGUP00000001165 ENSTGUP00000001165 59729.ENSTGUP00000001165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]