SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001178 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000001178
Domain Number - Region: 90-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 63-96
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0177
Family TNF receptor-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001178   Gene: ENSTGUG00000001147   Transcript: ENSTGUT00000001190
Sequence length 127
Comment pep:novel chromosome:taeGut3.2.4:2:17896958:17898606:1 gene:ENSTGUG00000001147 transcript:ENSTGUT00000001190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFQSLQEDIQNYFESHLHGLQNQVRNHLQKSYSVHKVEVDAKVINVGESLLDCGLCESDE
FCNFQKTPSQCEKCTLCPAGFFQMAECSANSDRICQDRDECTESPSICGERIKCLNTPGK
LYSLIIK
Download sequence
Identical sequences A0A091F3L6 H0YSB8
ENSTGUP00000001178 ENSTGUP00000017096 ENSTGUP00000001178 ENSTGUP00000017096 59729.ENSTGUP00000001178 59729.ENSTGUP00000017096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]