SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001194 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000001194
Domain Number - Region: 258-353
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000366
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001194   Gene: ENSTGUG00000001161   Transcript: ENSTGUT00000001206
Sequence length 1137
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:18229073:18409195:-1 gene:ENSTGUG00000001161 transcript:ENSTGUT00000001206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAPRSRSTESTILAQRLAEEVPQDVASFLYTGDSRELRRANCSERYELASLAGKSRFTSH
PSLHGALGTLTHATNLLNMILQSNKSREQNLQEDLEWYRALIRSLLEEDPNISRAAITFS
TEPFSSTPQVFLQASRHGSQVLLQDLSSTAHRLANASVETEWFHGLKRKWRPHLHRKVLN
TGPKTLENSWKRRESFSADKNHIRWSSPYLECENGNYKPGWLVTLSAAFYGLRPNLLPEF
RGVVKVDINLQKVDIDQCSNEGWFSGTHRCHLNNSECMPIKGLGFVLGAYKCICKAGFYH
PNIFSVNSFQRKDAENRFSGGELSEEVYTCLPCREGCSFCTDDTPCYAQEDKYLRLAIIS
FQTLCMLLDFISMLVVYHFRKAKSIRASGLVLLETILFGSLLLYFPVVILYFEPSIFRCV
LLRWVRLLGFATVYGTVTLKLHRVLKVFLSRTAQRIPYMTGGRVMRMLSVILLVVFWFLI
GWTSAITQNLERNIPLIGQGQTSDHLIFNMCLIDRWDYMMAVAEFLFLLWGVYLCYAVRT
VPSAFHEPRYMAVAVHNELIISAIFHTIRFILSSRLQSDWMLMLFFAHTHLTVTVTVGLL
LIPKFSHSSNNPRDDIATEAYEDELDMGRSGSYLNSSINSAWSEHSLDPEDIRDELKKLY
AQLEIYKRKKMIANNPHLQKKRCSKKGLGRSIMRRITEIPETVTRQCSRDEKDLMEHSAV
KNLATLKKNPPDSTSSPKPKEDTLKNRVFSLKKSHSTYDHVRDQTEEPNGLTTESAEVIA
SEKTLLDSLNGNKLTKNAPEKVEAVSTESVPLVCKSVSAHNLSADKKPLHPRTSVLQKSL
SVIASAKEKTLGLTGKTQSLEESTKSHKSQQKGKEASKKHSASDKGEHKDSHRKNSTQSE
EAKKTHKSGIIKQQRVSQTPANPDTGPGKSLHQDNFNIGEVCPWEIYDQVPGPVPFDSKA
QKHVSIASSEPEKNHPSQPKGKTHHKLKTPEGYQQSNQKSSENVEAATQETQEQQILENE
KNQSNSKSQVSPGLKCENVNRNTPNTCAGERDEPPQKTAEKENLNKLAEQKKIASSEGNV
LSSNSHKPSSYVQQPLASRAEVCPWEYDTADLPNAERSVAFLNTSAISANKTAASRK
Download sequence
Identical sequences H0YSD4
ENSTGUP00000001194 ENSTGUP00000001194 59729.ENSTGUP00000001194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]