SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001242 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001242
Domain Number 1 Region: 184-303
Classification Level Classification E-value
Superfamily EF-hand 2.82e-34
Family Osteonectin 0.023
Further Details:      
 
Domain Number 2 Region: 272-368
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 5.62e-28
Family Thyroglobulin type-1 domain 0.00087
Further Details:      
 
Domain Number 3 Region: 120-168
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000133
Family Ovomucoid domain III-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001242   Gene: ENSTGUG00000001204   Transcript: ENSTGUT00000001254
Sequence length 426
Comment pep:known chromosome:taeGut3.2.4:13:8568948:8837824:-1 gene:ENSTGUG00000001204 transcript:ENSTGUT00000001254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAWCFLQVESRHPEIITSNSNHGNFLDNDKWLSTVSQYDKDKYWNKFRDDDYFRNWNPNK
PFDQALDPSKDPCLKVKCSPHKVCVTHDYETAICVSRKQLVHRQKKGNLAQKHWAGAANV
AKCKPCPVAHSSAVCGSDGHTYSSQCKMEFHACTSGKTITTRCEGPCPCLPGPESLKHKT
EKTACTDKELRSLASRLKDWFGALHEDANRVIKPTSSETAQGRFDTSILPICKDSLGWMF
NKLDMNYDLLLDPSEISAIYLDKYEPCVKPLFNSCDSFKDGKLSNNEWCYCFQKPGGLPC
QNEMNRIQKLSRGKILFGVFIPRCNEEGYYKATQCHDSTGQCWCVDKYGNEIAGSRKRGT
VSCEEEQETSGDFGSGGSVVLLDDLEEEPEATKKDKEGKLKIHVRAANEDDEDEDDDKDD
EIGYIW
Download sequence
Identical sequences H0YSI2
ENSTGUP00000001242 ENSTGUP00000001242 59729.ENSTGUP00000001242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]