SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001243 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000001243
Domain Number - Region: 1-28
Classification Level Classification E-value
Superfamily RING/U-box 0.000184
Family RING finger domain, C3HC4 0.036
Further Details:      
 
Domain Number - Region: 123-173
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0117
Family Ubiquitin-related 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001243   Gene: ENSTGUG00000001203   Transcript: ENSTGUT00000001255
Sequence length 287
Comment pep:novel chromosome:taeGut3.2.4:2:19591279:19594299:-1 gene:ENSTGUG00000001203 transcript:ENSTGUT00000001255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFY
AAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRQRKGNKEKEKSKEEVN
DKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNG
PLPLKYRVRPTCKRMKISHQREGLNNSGELESDSGSDKASSPAGGIPSTSSCLPSPSTPV
QSPHPQFPHISSTMNGTSSSPSSNHQSSFTNRARKTSINGSSATSSG
Download sequence
Identical sequences H0YSI3
ENSTGUP00000001243 59729.ENSTGUP00000001243 ENSTGUP00000001243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]