SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001266 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001266
Domain Number 1 Region: 5-130
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-21
Family MAM domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001266   Gene: ENSTGUG00000001229   Transcript: ENSTGUT00000001278
Sequence length 130
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:20843547:20855878:-1 gene:ENSTGUG00000001229 transcript:ENSTGUT00000001278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YYTSIPGSCNFETQDQEWTTVCGLTQDTTDDFDWNISNGAVTGQTDPHTDHTPGKGQRFL
YVNSSTQKEGNRARITTTKFFPASLGVCRVRFWFWMFPSRQTGVLKVYTVEEHGMDILMW
SSSRNEENKW
Download sequence
Identical sequences H0YSK6
ENSTGUP00000001266 59729.ENSTGUP00000001266 ENSTGUP00000001266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]