SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001267 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001267
Domain Number 1 Region: 1-169
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.86e-39
Family MAM domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001267   Gene: ENSTGUG00000001230   Transcript: ENSTGUT00000001279
Sequence length 170
Comment pep:novel chromosome:taeGut3.2.4:2:20917927:20920914:-1 gene:ENSTGUG00000001230 transcript:ENSTGUT00000001279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HCNFEFDFCGWKQDENDDFDWYLRTSSTAKLGTGPATDHTLQESSGHYIFIKSSFFQLPG
QKARISSPVLSRKNKNCKVCEGVVVAGMIIFYYHMYGAHIGSLIIYQRTTLKHEKILLNL
TGNQGNYWQRKALTMSGDGDDDFQVVFEGIAGEGPKDGIALDDLTFSREC
Download sequence
Identical sequences H0YSK7
ENSTGUP00000001267 59729.ENSTGUP00000001267 ENSTGUP00000001267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]