SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001271 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001271
Domain Number 1 Region: 209-344
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.07e-37
Family MAM domain 0.0028
Further Details:      
 
Domain Number 2 Region: 1-161
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-35
Family MAM domain 0.0026
Further Details:      
 
Domain Number 3 Region: 169-206
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000838
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001271   Gene: ENSTGUG00000001231   Transcript: ENSTGUT00000001283
Sequence length 344
Comment pep:novel chromosome:taeGut3.2.4:2:20958608:20961814:-1 gene:ENSTGUG00000001231 transcript:ENSTGUT00000001283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDFERESCGWIEAVNTDEFDWVRSSSNALPPAFQKQAPPRDHTYNKPEGHFMFILKSSNS
ISQIARLRSPKFRQTGSNCTLSFWYYNYGESVGAAELQLLVDGLGQPTVLWRTYYNEGNQ
WLKAVIQLGRLPHPFQFSLEKISLGVYEGVSAIDDIRFENCALPPPALICEGPNRFWCRD
TKACIDSLLVCDLVDDCGDGSDEDNCDPDLQCNFENGLCNWEQDVQDDFDWIRIRGPTPT
VNTGPLKDHTTGTARGHYLYLESSEPRLFQDKAVLLSPLFNPSGYGTCVFRFHYHMFGKE
VYKLSVFQRTVSNAKGWLLWYKFGNQENRWIRQTLFISSSKPFQ
Download sequence
Identical sequences H0YSL1
ENSTGUP00000001271 ENSTGUP00000001271 59729.ENSTGUP00000001271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]