SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001309 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001309
Domain Number 1 Region: 141-210
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000403
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 2 Region: 200-260
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000181
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 88-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000105
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 5-123
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000137
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 508-590
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000443
Family Fibronectin type III 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001309   Gene: ENSTGUG00000001267   Transcript: ENSTGUT00000001321
Sequence length 707
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:25714455:25749426:1 gene:ENSTGUG00000001267 transcript:ENSTGUT00000001321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVCATCHIHATCQQSGGKSVCICNYGFVGNGRTHCQDKDECQIGASKICGNHTLCHNTHG
SFYCVCLDGYRASNNNKTFIPNDGTNCTDIDECEESGLCGHNARCVNTEGSYMCYCNDGY
KLETGERSFHQDGNIVSCKEIRCGSPPEMKHGYIVGSSSLLPGSAVHYECQEGFYSNEGK
FSYCTANETWEPATLSCKGVDCGAPPSVLNARPISASGTTYRSEVTYDCVHGYLMAGGSS
TAVCNAKGQWDGPDLVCKDIKELFSNLSIFNETCVKWQRKTGRLGVQETYTFHILGQRLD
EKIFSEDVIFNISTNENNPKVCLDLDSGSNYMVNITTISSRNITVSVTVAIQTRERAVPR
LHSSLSAGFWFCLKQNLCCKRIPSSKKYQLGVSDIRKKSKIFSEDVIFNISTNENNPKVC
LDLDSGSNYMVNITTISSRNITVSVTVAIQTKVKEAFNNVLIFNDTCLKWRRNVRGTDVE
DRYSFHVQGQRWYQKNFFHEMTFKLSTHKQAPEVCLDLQPGTNYSVNISMVALNFSLLVS
MTTQITDPPFPEVEFVAVKGSAPLLRLRKAEDQNGPISLYQVIVLPLDLQSTFICDSFDA
TAFFSNTTDIKGYVAAEFQAKDVADNMSIALGDRHYYGKFYNAPLKLGEEYCVFLKIISE
WNKVRTQSCAVWAQIKNLPPTLQYMTAVGLGSVAAVCLILFVSFSMA
Download sequence
Identical sequences H0YSP8
59729.ENSTGUP00000001309 ENSTGUP00000001309 ENSTGUP00000001309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]