SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001337 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001337
Domain Number 1 Region: 1259-1462
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.68e-37
Family Pentraxin (pentaxin) 0.0011
Further Details:      
 
Domain Number 2 Region: 2724-2793
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.63e-20
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 1983-2052
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.1e-19
Family Complement control module/SCR domain 0.00079
Further Details:      
 
Domain Number 4 Region: 2666-2735
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.61e-19
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 5 Region: 2334-2403
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.21e-19
Family Complement control module/SCR domain 0.00092
Further Details:      
 
Domain Number 6 Region: 1626-1694
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.2e-18
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 7 Region: 3074-3143
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.92e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 8 Region: 2219-2287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.37e-18
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 9 Region: 2550-2619
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.37e-18
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 10 Region: 2608-2672
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.69e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 11 Region: 1742-1809
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-17
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 12 Region: 2782-2846
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.02e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 13 Region: 3133-3199
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.98e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 14 Region: 1800-1868
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.01e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 15 Region: 1526-1583
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.03e-16
Family Complement control module/SCR domain 0.00073
Further Details:      
 
Domain Number 16 Region: 3251-3310
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.07e-16
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 17 Region: 2276-2345
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.39e-16
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 18 Region: 1685-1747
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.31e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 19 Region: 2102-2169
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000027
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 20 Region: 2392-2460
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000499
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 21 Region: 4-82
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000000695
Family Integrin A (or I) domain 0.007
Further Details:      
 
Domain Number 22 Region: 2957-3021
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000123
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 23 Region: 2041-2112
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000403
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 24 Region: 2505-2561
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000612
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 25 Region: 1474-1537
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 26 Region: 199-270
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000375
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 27 Region: 3192-3259
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000584
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 28 Region: 260-327
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000737
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 29 Region: 2161-2229
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000101
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 30 Region: 1148-1255
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000188
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 31 Region: 2842-2902
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000297
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 32 Region: 827-975
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000051
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 33 Region: 1857-1925
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000612
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 34 Region: 2897-2958
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000862
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 35 Region: 3015-3079
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000153
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 36 Region: 1922-1989
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000514
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 37 Region: 1063-1105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000703
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 38 Region: 1027-1067
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000706
Family EGF-type module 0.015
Further Details:      
 
Domain Number 39 Region: 1101-1132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000382
Family EGF-type module 0.009
Further Details:      
 
Domain Number 40 Region: 1584-1621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000725
Family EGF-type module 0.023
Further Details:      
 
Domain Number 41 Region: 100-256
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000012
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 42 Region: 319-376
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000306
Family Complement control module/SCR domain 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000001337
Domain Number - Region: 3341-3371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000293
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 3302-3338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000537
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 3370-3400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00129
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 551-613
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00144
Family Complement control module/SCR domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001337   Gene: ENSTGUG00000001297   Transcript: ENSTGUT00000001350
Sequence length 3404
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:26151227:26257530:-1 gene:ENSTGUG00000001297 transcript:ENSTGUT00000001350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QILRHARGNATKVIFLITDGYSNGGDPRPIAASLRELGVEIFTFGIWQGNIRELNDMASH
PKEDHCYLLHSFTEFEALARRALHEDLPSGSYIQEDTLHCSYLCEANENCCDIMASCKCG
THTGQFECICEKGYYGKGLQHECTACPPGTYKPEGSPGGISTCISCPDENHTSPPGSTSL
EDCTCREGYRAVGQTCEVVHCPELKPPENGHFVQNVCNNYFNAACGIRCKTGFDLVGSSI
RLCQPNGQWSGSEATCRVRTCPRLWSPQNGHINCSTADISYKTVCFVTCNEGYEIEGNSK
LTCQGTSQWDSKEPKCVEKRCPILQKPAGVTLVPPSCGLEPAISGTVCQLSCPQGFILSG
AREEIRCISFGRWSANIQEALCKDIEAPQIHCPDNIETVTLEHHNSANISWQVPTAKDNS
GEEQVSVHVTPAFIPPFLLPIGEVDITYAATDTSGNEARCTFSIKVIDAEPPVVDRCRSP
PPMQAAENDYTATWEEPEFSDNSGGPLTVTRSHAPGNLFPKGETTVQYTAVDPSGNNRTC
EIHIVIKGSPCDVSFEPVNGDFVCTSDEAGVNCTLHCAEGYSFSEGSSENYYCAYDDGLW
KPPFSPGWPSCSLNRFANHGFKSFEMLYKATRCDDNTLLNSFTDAFQSALGKMVPSFCND
VDDIDCRLEDQTQKHCLEYNYDYENGFAIGPAGWGTANHLDYSYGDFVDAVQGEDLSKHL
SASVKAAPARVKRHKLNVSMTDQKIKLIFNITASVPLPDERNDTVELENQRRLLKTLETI
TNRLNRTLNKEPMYSFQFASELIVADTNSLDTQKAFLFCRPGSVLRGRMCVNCPLGTYYS
LEHLTCQSCWTGSYQDEEGQLECKSCPSGSYTEYLHSRSISDCKAQCKRGTYSPNGLETC
ETCPLGTYQPSFGSRNCISCPENTLTVKRGAVDVSACGVPCLAGEFSRTGLTPCHPCPRD
YYQPDPGKSYCLSCPFYGTTTVIGARSITDCSSFGSTFSAAEESIMMVPAFPENISKQYK
VSSQVFHECFLEPCHNNGTCKQLGSGYICICPLGYTGLKCEAQVDECKSSPCQNNGICKD
GIGTFVCHCQPGYSGLLCEEDINECSSSPCMNGARCVDGKNGYHCTCAKGFTVAQKSFSG
KFNLELLLCSFFSPAVCEDRVGSFSCKCLPGFTGVLCERNIDECLSRPCRNGATCRDGIS
SFRCLCVAGYTGQNCEVNINDCASSPCLNQATCVDALNSYVCKCPPGFTGSRCETEQSSG
FNLDFEVSGIYGYVMLDGVLPSLGDITCTFWMKSTDTTNYGTPISYAVENGSDNAFLLTD
YNGWVLYVNGKEKITDCPSVNDGNWHHIAVTWTCRDGAWKVYIDGKLSDGGSGLSVGSKI
PGILGGGALVLGQEQDQKGEGFNPAESFVGSISQLNIWNHVLSPQQVESLATSCPEELQK
GNVLAWPDFLPGVVGRVKIDYKSIFCADCPSLQGSIPHLRASSADLKPGSKVSLSCDPGF
QIVGNSVQHCLNLGQWTRPFPRCERISCGVPPTLENGFYSAEDFFAGSTITYHCNSGYYL
LGDSRMLCLDNGSWNSISPSCLADVDECAVGSDCDEHASCLNTNGSYVCTCIPPYTGDGK
KCAEPVKCYNPGNPEHGHLHGDTYSVGSQVTFSCQEGFQLTGATKLTCMESGEWSHPTPY
CKAISCGAPVIPENSAIFGSNFTYHNKVVYRCNDGYNLVGEKEILCLASGVWNHAPPSCE
MVMCPPPQDISNGKYIFSGTTYLSSVSYTCDNGYSLQGPSVLVCASSGNWNSTPPVCEIV
SCGHPPAIKDAVIKGDNFTFGNTVSYMCKEGYTLVGPETTECLASGKWNVSHQQCLAVSC
DEPPHVENASPEIGHRLFGDIAYYFCLDGYSLADNSQLLCNAEGKWVPPEGRDMPHCIAD
FCEKPSTVSYSILESISKAKFSAGSIVSFKCMEGFVLNSSAKIECLRGGQWNPSPLSIQC
IPVRCGEPPHISNGYASGSNYSFGAVVAYSCNKGFYIKGEKKRTCDATGNWSGSLPTCHP
VSCGEPPQLENGFIKDTSGHFFENQANYQCESGYQMVGSPVFICQANRQWYSELPPYCAP
LSCGKPPSIQHGYSKGETFDMGSKVEFFCDEGYELIGDVSWTCQKSGKWSKKQSPKCVPT
KCPEPPLAENQLVLREVSYQVGVVQFSCKEGYILHGSSILKCLPSQQWNDSFPFCKVAQC
SAPPYIPFGDPLTSSLHFGSTVKYVCVDGFLLKGESTIRCQADGSWSLPLPECIPVECPQ
PEEIQNGIVDVQGLTFLSTALYTCKPGFELLGNTTVLCGEDGQWLGGKPVCKPIQCPRPK
KILNGKYSFTNFHYGQTVRYFCDRGFQLQGEETLRCLETGEWSTEVPSCKAINCQPPQPI
ENGFVEGADYSYGAMVIYSCLPGFQLSGLAMQTCEELGWSSSTPACLPTDCGLPPHIDFG
EYVQLRHGERRSDQEGVTENPSLSHMLLADNMKDFKSSLKEDSAMQLTTFLFGTIILYTC
YSGYELLGNPVLACQEDGAWNGTAPTCVSIECTLPSPPENGFLHVTENRLGSAVRYFCRP
GFTLEGSDTRLCLPSRQWSHTAPYCKAITCNSPTHLLNGKIRGENYTYGSVVYYECDPGY
QLNGPTERRCQESQKWDGSEPICIPVSCSPPPVLENGQVTGEDYTFQRRTEYSCNEGFLL
DGDRSRVCLANGSWSGITPVCRAVTCPVLLPLPNGRTTGSDFSFNKAVHYHCNDGYTLQG
ASTLTCQSDGTWDSEAPHCEPVICGPPEDISHGFLNGSAFTFGEFVHYICFPGYELHGNP
LRQCLSNGSWSGSLPSCLPCLCPTPQIQNGVILGTDFSCGVSVQFQCLEGFKLLGPPEVT
CEAAGKWSSGFPRCGQISCGAPPIIPNTFINGSSSEDENTIIYTCLTGFVMKEGPELTCV
ETGVWKKPYPSCELLSCGPPPSIPNAEVFGSTYTYGSKVQYRCLEGYTMATDVDVCTCQE
DGQWSPQSISCCPRKCPLPGNITNVIAFGNNFTVNTSITLSCVEGYTLVGANTSTCKENG
VWVPPFSDDICSPVSCGTPESPEHGFVVGTKYNYKDVSLYKCDSGYELQGDAERTCQEDK
LWSGTVPVCRKTRCKIPVSLLNGKAIYENNTVGSTVTYLCEKGYSLEGEPAAECTRDGRW
SNPLPLCKPNPCPVPFIIPENALLSEVDFHVGQNVSIRCREGYQLEGQSVITCNADETWT
PATAKCEKISCGPPAHVENALIRGSFYQYGDMITYSCYSGYMLEGPLRSICLENGTWTTP
PTCKAVCRFPCQNGGICERPNACSCLDGWMGRLCEEPICILPCLNGGRCVAPYQCDCPLG
WTGSRCHMAVCQLPCLNGGRCIRPNRCYCPSSWTGPDCSRSRAA
Download sequence
Identical sequences H0YSS6
ENSTGUP00000001337 59729.ENSTGUP00000001337 ENSTGUP00000001337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]