SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001352 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001352
Domain Number 1 Region: 382-604
Classification Level Classification E-value
Superfamily Ras GEF 2.88e-31
Family Ras GEF 0.0021
Further Details:      
 
Domain Number 2 Region: 260-384
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.02e-18
Family cAMP-binding domain 0.0014
Further Details:      
 
Domain Number 3 Region: 16-119
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000249
Family cAMP-binding domain 0.0031
Further Details:      
 
Domain Number 4 Region: 755-816
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000258
Family Ras-binding domain, RBD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001352   Gene: ENSTGUG00000001310   Transcript: ENSTGUT00000001365
Sequence length 830
Comment pep:novel chromosome:taeGut3.2.4:13:10895338:10991633:-1 gene:ENSTGUG00000001310 transcript:ENSTGUT00000001365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPVEPRIKQALRKKPAERTPEDLNTIYSFLHGLDILSHFREHQLRIMSSSARYERYKG
NQVLFCSETIARCWYILLSGSVLMKDSMFLPPCSFGKQSGGKRGCECIILEPSEMIVVEN
SKDNEENILQREVPLRQSRRRYRKINQRGERQTITDNVDSSSYMSLPADLTKMHLTDNPH
PQVTHVPSSQSGCSIASDSGSSSLSDIYQATESEMGDVDLTGLPEAPVDSEDEEEEEDED
IDRTSDPLLGRDVVRECLEKEPADKTDDDIEQLLEFMHQLPAFANMTMSVRRELCSVMIF
EVVEQAGAIILEDGQELDSWYVILNGTVEISYPDGKSESLCMGNSFGITPSLDKQYMNGV
VRTKVDDCQFVCIAQQDYWRILNHVEKNTHKVEEEGEIVMVKEHRELDRSGTRKGHIVIK
ATPERLIMHLIEEHSIVDPTYIEDFLLTYRTFLTSPLEVGNKLLEWFTVDSLRDKVTRVV
LLWVNNHFNDFEGDPAMTRFLEEFEKNLEDTKMKGHLRLLNIACAAKAKWRQITLQKPSR
DSPLFFSLLGGSDKGFGIFVETVEIGSKAAEAGLKRGDQIMEVNGQNFENITFVKALEIL
KNNTHLSITVKTNIFVFKELLCRIGQEKNGIPHIPKIAEKKNNRYSIPDMPGDVEQMFPR
EKGNKKMKANTVSGGRNRIRKILDKTRFSILPPKLFSDGSVSQSQDDSIVGTRQCRHSLA
IMPIPGTLSSSSPDLLQPTTSILDFSNPSDIPDQVIRVFKADQQSCYIIISKDTTAKEVV
SHAVHEFNLTGAPETYSLCEVSVSPEGVIKQRRLPDQFSKLADRIQLNGR
Download sequence
Identical sequences H0YSU1
59729.ENSTGUP00000001352 ENSTGUP00000001352 ENSTGUP00000001352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]