SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001382 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001382
Domain Number 1 Region: 537-707
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-18
Family SPRY domain 0.023
Further Details:      
 
Domain Number 2 Region: 198-261
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.94e-16
Family B-box zinc-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 426-505
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000126
Family Fibronectin type III 0.0057
Further Details:      
 
Domain Number 4 Region: 4-42
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000167
Family RING finger domain, C3HC4 0.033
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000001382
Domain Number - Region: 142-193
Classification Level Classification E-value
Superfamily RING/U-box 0.0353
Family ZZ domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001382   Gene: ENSTGUG00000001340   Transcript: ENSTGUT00000001395
Sequence length 713
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:27115200:27138831:1 gene:ENSTGUG00000001340 transcript:ENSTGUT00000001395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AIKGIERELICPACKELFTHPLIIPCQHNVCHKCVKEILFAFEDSFADGGSESSNQSSPR
IRISASSMDRIDRINRSGILVYAHPKLGFDVYAGRKRNSLTPRSTLFPCPSCQRDIDLGE
RGINGLFRNFTLETIVERYRQAARAAIAIMCDFCKPPPQESTKSCMDCSASYCNECFKIH
HPWGTVKAQHEYVGPTTNFRPKILMCPEHEMERVNMYCEICRRPVCHLCKLGGSHANHRV
TTMSTAYKTLKEKLSKDIEYLISKESQVKAHITQLDLLLKETECNSERAKQEASQSFEKL
YHVLEEKKSAALRAIETSKNRRLEKLQTQVEEYQGLLENNGLVGYAQEVLKETDPSCFVQ
TAKQLHVRIQKATESLKSFRPAAETTFEDFVVDTAKQEDILGDLSFHSNGLEIPEINEAQ
SRMYKKALISWECPGKTESADTYVLEYHKLTKEEESVTWQKTEVCGKSKVLSDLDDDSSY
AFRVRGYKGSICSPWSREVIMRTPPAPGMGFLFDDKCGYNNEHLQLNPRRTSVESRAGFP
LLLGSERLQVGCYTTLDYIIGDTGIAKGKHFWAFTVEAYSYLVKVGVVPSNKIQKLFHNT
HDVTSPRYEQDSGHDSGSEDTFFDSSQPCTLVTLGMKKFFIPATPAAPKDPASRILPLPS
CLGICLDCDRGRVGFYDAGRMKCLYECEVDCSGLMYPAFALMGSAAVHLEEAV
Download sequence
Identical sequences H0YSX1
ENSTGUP00000001382 59729.ENSTGUP00000001382 ENSTGUP00000001382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]