SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001438 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001438
Domain Number 1 Region: 823-1111
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-82
Family Protein kinases, catalytic subunit 0.0000000000429
Further Details:      
 
Domain Number 2 Region: 599-737
Classification Level Classification E-value
Superfamily Fibronectin type III 1.37e-20
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 3 Region: 445-638
Classification Level Classification E-value
Superfamily Fibronectin type III 7.97e-18
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 4 Region: 351-450
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000382
Family I set domains 0.023
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000001438
Domain Number - Region: 220-332
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000408
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 140-213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0372
Family V set domains (antibody variable domain-like) 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001438   Gene: ENSTGUG00000001382   Transcript: ENSTGUT00000001451
Sequence length 1128
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:29257360:29295176:1 gene:ENSTGUG00000001382 transcript:ENSTGUT00000001451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMDPLAHLVLYGFSLLISGKVEAALDLILINSFPLVGNSETSLICVTSKWHSRESITIGR
DQEGVANQHREPLEVNEDSKRAAAKTVVWKREQASETIGAYYCEGKLKDEVTRIHTMKMP
LGASFYPVALTVTANKGEHVNISFIRMASKEEDAVIYKNGSFIHSVPRHEVPGELEVSYP
QVQPQDAGVYSARYIGGNLFTSAYTRLIVRRCEAEKWGPSCSFHCPSCTNNGICHEDTGE
CICPPGFMGKTCEKACGANTFGKTCEETCKENYGCRNFMFCLPDPYGCSCATGWMGLECD
KECTPGFYGSDCKLKCNCHNRGTCNRFKGCICSFGWHGPQCEKKGSADLSPQIVNLLDPV
ELNSGVEFKPFCIATGMPLPKSEEFKLLKQDGTVLKPDEISTSNHSEAMFRINRVLPGDT
GTWVCSVQTVAGMAEKPFQVTVKVPPVPQYAPRLTDRGHNFLVIDINAELHYGDGPVVST
KLLYKPEKRYQSWMSVEVKGTTKRLDNLEPKTEYQFCVQLSRQGEGGEGHPGPQASFTTA
ALGLPPPEGITLFPKSMTSLNLSWHPLTLRTEDDIRVEVERKTVNDNDDKSSVITQVPGN
MSTLIIKDLEPRQQYMCRVRVNTRSQGEWSNYLYAWTFSDRIPPAPNNIRFSNITDTSSV
ISWTAAEGHSISSIIISYKIYGKAEYNHIDIIIKNTSITQYHLKGLEPDTVYQVQINAQN
NIGLSNPNTSFELKTLPETKASYESKGGKMLLIAILGSAGMTCVTILLAFLIMLQLKRAN
FQHRMAQAFQNVREEPALQFNSGTLTLSRKAKTSPDPTVYPVLEWNDIKFQDVIGEGNFG
QVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRG
YLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLS
QKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYT
TNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWK
EKPYERPSFAQILVSLNRMLEDRKTYVNTTLYEKFTYAGIDCSAEEAA
Download sequence
Identical sequences H0YT27
59729.ENSTGUP00000001438 ENSTGUP00000001438 ENSTGUP00000001438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]