SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001514 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001514
Domain Number 1 Region: 226-404
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.64e-26
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 521-630
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000131
Family Second domain of FERM 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000001514
Domain Number - Region: 422-513
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0258
Family Ras-binding domain, RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001514   Gene: ENSTGUG00000001459   Transcript: ENSTGUT00000001527
Sequence length 736
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:24812243:24829335:-1 gene:ENSTGUG00000001459 transcript:ENSTGUT00000001527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNPENIGDAYVAVIRPKNTASLNSREYRAKSYEILLLEVPIEGQKKKRKKVLLETKLQG
GAEITQSILDYVLEATKPISPANQGIKGKRVVLMKKFPLDGEKAGQEASLYIVPTVVKDN
TKYTYSPGCPVFYCFQDIMRVCSESSTHFATLTAKMLIALDKWLDERHTQSHSIPALFRP
SPLERIKTNVINPAYAIEPGQTESSLHMGYTALEIKSKMLALEKADMCIYNPLFGSDLQY
TNRVDKVVINPYFGLGAPDYSKIQIPKREKWQRSMSSVTEDKEHQWVDDFPLHRSACEGD
SDLLSHLLDKKFSVNQLDSDHWAPIHYACWYGKVEATRMLLEKGKCNPNLLNGQLSSPLH
FAAGGGHAEIVQILLNHPEIDRHITDQQGRSPLNVCEENKQNEWEEAAKLLKEAINKPYE
KARIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQQYFTIWICSENLSLQLKPYHKP
LQHIRDWPEIFTELTNLDPQRETSQLFLRRDVRLPLEIEKKIEDPLAILILFDEARYNLL
KGFYTSPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPITKLKSKAPHWTNR
ILHEYKNLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKASSSSHKVIKVYV
GVNVKGLHLLNMETKALLLSLKYGCFMWQLGDGDTCFQIHSLENKMSFIVHTKQAGLVVK
LLMKLNGQLMPTERNE
Download sequence
Identical sequences H0YTA1
59729.ENSTGUP00000001514 ENSTGUP00000001514 ENSTGUP00000001514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]